Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6J3M175

Protein Details
Accession A0A6J3M175    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
46-71HAMPPGKRRWWWRRRQRAWTARRSGSHydrophilic
NLS Segment(s)
PositionSequence
50-71PGKRRWWWRRRQRAWTARRSGS
Subcellular Location(s) plas 18, mito 4, cyto 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences MSVHTAPSGYTSARQPTFYFPFCSWEDSVMNCSPDRLECGLDARIHAMPPGKRRWWWRRRQRAWTARRSGSIRPKVTPGVCALFSVCFVSCFFVFSQSSGGIRNLGHALCTGLVTCSVATAPCDLPTSCVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.34
4 0.39
5 0.39
6 0.39
7 0.32
8 0.35
9 0.34
10 0.37
11 0.3
12 0.27
13 0.26
14 0.23
15 0.27
16 0.24
17 0.24
18 0.2
19 0.19
20 0.17
21 0.16
22 0.19
23 0.16
24 0.14
25 0.13
26 0.16
27 0.18
28 0.18
29 0.17
30 0.16
31 0.15
32 0.14
33 0.15
34 0.17
35 0.17
36 0.22
37 0.29
38 0.29
39 0.33
40 0.43
41 0.52
42 0.58
43 0.65
44 0.71
45 0.76
46 0.81
47 0.87
48 0.88
49 0.87
50 0.86
51 0.84
52 0.8
53 0.71
54 0.67
55 0.6
56 0.56
57 0.56
58 0.56
59 0.49
60 0.43
61 0.44
62 0.44
63 0.41
64 0.36
65 0.28
66 0.22
67 0.2
68 0.19
69 0.17
70 0.12
71 0.12
72 0.12
73 0.09
74 0.08
75 0.08
76 0.1
77 0.09
78 0.11
79 0.1
80 0.13
81 0.13
82 0.13
83 0.15
84 0.13
85 0.14
86 0.14
87 0.15
88 0.13
89 0.12
90 0.14
91 0.14
92 0.13
93 0.13
94 0.11
95 0.12
96 0.1
97 0.11
98 0.09
99 0.07
100 0.08
101 0.08
102 0.07
103 0.07
104 0.07
105 0.07
106 0.08
107 0.11
108 0.12
109 0.12
110 0.16
111 0.15