Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6J3LW26

Protein Details
Accession A0A6J3LW26    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPAATGAKKQKKKWSKGKVKDKAQHAVIHydrophilic
NLS Segment(s)
PositionSequence
8-23AKKQKKKWSKGKVKDK
Subcellular Location(s) cyto 9, nucl 8, mito 8, mito_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAATGAKKQKKKWSKGKVKDKAQHAVILDKAINDKLQKDVQSYRLVTVAVLVDRLKINGSLARRALADLEERGVIKQVISHSACKVYTREIGGAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.86
4 0.89
5 0.93
6 0.92
7 0.92
8 0.89
9 0.85
10 0.82
11 0.72
12 0.65
13 0.55
14 0.48
15 0.38
16 0.32
17 0.26
18 0.18
19 0.18
20 0.14
21 0.15
22 0.13
23 0.13
24 0.14
25 0.17
26 0.18
27 0.2
28 0.22
29 0.24
30 0.28
31 0.27
32 0.24
33 0.22
34 0.21
35 0.17
36 0.15
37 0.12
38 0.07
39 0.07
40 0.06
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.08
47 0.1
48 0.12
49 0.15
50 0.15
51 0.16
52 0.16
53 0.16
54 0.16
55 0.14
56 0.14
57 0.11
58 0.12
59 0.12
60 0.12
61 0.12
62 0.13
63 0.12
64 0.09
65 0.11
66 0.12
67 0.18
68 0.2
69 0.23
70 0.23
71 0.27
72 0.28
73 0.28
74 0.28
75 0.26
76 0.28
77 0.29