Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6J3MHU6

Protein Details
Accession A0A6J3MHU6    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
87-118QQEIKRKKKASATKKSRRKYKKLDGDRDDKEABasic
NLS Segment(s)
PositionSequence
91-108KRKKKASATKKSRRKYKK
Subcellular Location(s) nucl 21, cyto_nucl 16.833, mito_nucl 11.831
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003747  F:translation release factor activity  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences LGNKALPPRLVIPESDLDESFLKGSGPGGQKINKTSSAVQLKHLPTGIVVKCQETRSRDQNRKLARRILAERLDFMEKGSQSRTAIQQEIKRKKKASATKKSRRKYKKLDGDRDDKEAET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.27
4 0.23
5 0.23
6 0.23
7 0.19
8 0.14
9 0.11
10 0.09
11 0.09
12 0.13
13 0.16
14 0.18
15 0.22
16 0.25
17 0.28
18 0.31
19 0.34
20 0.3
21 0.3
22 0.29
23 0.33
24 0.38
25 0.36
26 0.35
27 0.39
28 0.38
29 0.37
30 0.35
31 0.26
32 0.18
33 0.24
34 0.22
35 0.19
36 0.19
37 0.19
38 0.21
39 0.23
40 0.27
41 0.24
42 0.29
43 0.34
44 0.44
45 0.49
46 0.53
47 0.58
48 0.63
49 0.67
50 0.66
51 0.62
52 0.56
53 0.54
54 0.52
55 0.51
56 0.47
57 0.4
58 0.37
59 0.33
60 0.32
61 0.26
62 0.23
63 0.2
64 0.15
65 0.16
66 0.17
67 0.17
68 0.16
69 0.19
70 0.22
71 0.22
72 0.25
73 0.28
74 0.33
75 0.42
76 0.51
77 0.57
78 0.59
79 0.58
80 0.61
81 0.65
82 0.7
83 0.7
84 0.71
85 0.75
86 0.78
87 0.86
88 0.9
89 0.91
90 0.91
91 0.91
92 0.9
93 0.9
94 0.91
95 0.91
96 0.93
97 0.9
98 0.89
99 0.83
100 0.78