Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6J3MG17

Protein Details
Accession A0A6J3MG17    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MPKEKTTTRGTRKTKDGKKKKDPNMPKRGLSBasic
NLS Segment(s)
PositionSequence
9-28RGTRKTKDGKKKKDPNMPKR
Subcellular Location(s) nucl 17, cyto_nucl 12, mito 5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKEKTTTRGTRKTKDGKKKKDPNMPKRGLSAYMFFANDQRDKVREDNPGIKFGEVGKVLGEKWKALGEKQKAPYEAKAAADKKRYEEEKAAYTAVSLVGAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.84
3 0.85
4 0.86
5 0.89
6 0.92
7 0.91
8 0.92
9 0.92
10 0.92
11 0.92
12 0.87
13 0.79
14 0.72
15 0.65
16 0.57
17 0.48
18 0.39
19 0.31
20 0.27
21 0.24
22 0.2
23 0.2
24 0.2
25 0.19
26 0.18
27 0.17
28 0.16
29 0.19
30 0.22
31 0.23
32 0.25
33 0.28
34 0.34
35 0.34
36 0.36
37 0.33
38 0.3
39 0.26
40 0.21
41 0.21
42 0.14
43 0.12
44 0.09
45 0.1
46 0.1
47 0.13
48 0.13
49 0.09
50 0.1
51 0.13
52 0.14
53 0.16
54 0.24
55 0.27
56 0.34
57 0.4
58 0.43
59 0.43
60 0.45
61 0.45
62 0.41
63 0.38
64 0.32
65 0.35
66 0.35
67 0.38
68 0.42
69 0.42
70 0.42
71 0.47
72 0.48
73 0.45
74 0.48
75 0.46
76 0.45
77 0.45
78 0.42
79 0.33
80 0.3
81 0.25
82 0.18