Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6J3LXG2

Protein Details
Accession A0A6J3LXG2    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
13-35ATASSSKTPAKRRSKLAKEHDLTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito 12, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR011992  EF-hand-dom_pair  
Amino Acid Sequences MAPKRKQASTAAATASSSKTPAKRRSKLAKEHDLTAEEELEIQETFALFSRENDDFADTKEGVIATNDVRRCLIALNAPPRDNAELQELIETVDPEDSGWIPYEHFVAIAALKIHARHDDEDDNPDAVNEEVAKAYRLFTKGEDRAITMADLRRVAKELREEIPENVLKDMVREATGGGLGPVEMDDFEDVMRRAGVIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.31
3 0.22
4 0.2
5 0.21
6 0.26
7 0.35
8 0.44
9 0.53
10 0.58
11 0.67
12 0.76
13 0.81
14 0.84
15 0.85
16 0.85
17 0.78
18 0.75
19 0.68
20 0.59
21 0.51
22 0.42
23 0.33
24 0.22
25 0.19
26 0.14
27 0.12
28 0.09
29 0.08
30 0.06
31 0.05
32 0.06
33 0.07
34 0.08
35 0.07
36 0.08
37 0.13
38 0.13
39 0.14
40 0.15
41 0.16
42 0.15
43 0.17
44 0.2
45 0.16
46 0.15
47 0.15
48 0.14
49 0.12
50 0.12
51 0.11
52 0.08
53 0.13
54 0.14
55 0.14
56 0.14
57 0.14
58 0.13
59 0.13
60 0.13
61 0.12
62 0.17
63 0.23
64 0.26
65 0.27
66 0.27
67 0.28
68 0.29
69 0.25
70 0.21
71 0.18
72 0.15
73 0.15
74 0.15
75 0.13
76 0.11
77 0.11
78 0.1
79 0.06
80 0.05
81 0.05
82 0.04
83 0.05
84 0.05
85 0.05
86 0.05
87 0.05
88 0.05
89 0.06
90 0.07
91 0.06
92 0.06
93 0.05
94 0.05
95 0.05
96 0.05
97 0.05
98 0.05
99 0.06
100 0.06
101 0.07
102 0.09
103 0.11
104 0.11
105 0.15
106 0.17
107 0.18
108 0.21
109 0.22
110 0.2
111 0.18
112 0.16
113 0.13
114 0.1
115 0.1
116 0.06
117 0.05
118 0.05
119 0.06
120 0.07
121 0.07
122 0.08
123 0.11
124 0.12
125 0.13
126 0.15
127 0.23
128 0.25
129 0.28
130 0.28
131 0.26
132 0.25
133 0.25
134 0.22
135 0.17
136 0.17
137 0.16
138 0.18
139 0.17
140 0.18
141 0.19
142 0.2
143 0.21
144 0.24
145 0.26
146 0.27
147 0.32
148 0.33
149 0.32
150 0.38
151 0.37
152 0.32
153 0.28
154 0.26
155 0.2
156 0.19
157 0.2
158 0.15
159 0.12
160 0.12
161 0.11
162 0.11
163 0.11
164 0.1
165 0.08
166 0.06
167 0.05
168 0.05
169 0.05
170 0.05
171 0.04
172 0.06
173 0.06
174 0.06
175 0.07
176 0.1
177 0.1
178 0.11
179 0.11