Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6J3MHG1

Protein Details
Accession A0A6J3MHG1    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
66-91HKNARREDDTKNSRRKTRKKPTCLMRBasic
NLS Segment(s)
PositionSequence
76-85KNSRRKTRKK
Subcellular Location(s) mito 17.5, mito_nucl 11.5, nucl 4.5, plas 4
Family & Domain DBs
Amino Acid Sequences MRMFAVIIPAMVRIGLGNCRGRCSIQAGSKLVRSFLLLHHIDRSVGWYSSHPPSIDFKVTSSRMLHKNARREDDTKNSRRKTRKKPTCLMR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.1
3 0.15
4 0.21
5 0.22
6 0.25
7 0.27
8 0.27
9 0.27
10 0.3
11 0.32
12 0.3
13 0.35
14 0.35
15 0.35
16 0.38
17 0.36
18 0.31
19 0.25
20 0.2
21 0.16
22 0.14
23 0.19
24 0.16
25 0.17
26 0.18
27 0.18
28 0.17
29 0.15
30 0.17
31 0.12
32 0.11
33 0.11
34 0.1
35 0.14
36 0.16
37 0.18
38 0.15
39 0.15
40 0.18
41 0.21
42 0.23
43 0.2
44 0.19
45 0.23
46 0.25
47 0.26
48 0.25
49 0.28
50 0.3
51 0.36
52 0.43
53 0.43
54 0.52
55 0.56
56 0.6
57 0.59
58 0.57
59 0.58
60 0.61
61 0.65
62 0.65
63 0.68
64 0.69
65 0.73
66 0.81
67 0.85
68 0.85
69 0.86
70 0.88
71 0.88