Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6J3LUM4

Protein Details
Accession A0A6J3LUM4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
48-68ERPGLKRKRIRYEGKIRGFKABasic
NLS Segment(s)
PositionSequence
46-68FHERPGLKRKRIRYEGKIRGFKA
Subcellular Location(s) mito 15, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences LKLGPNVGRSFHVDAGRGLDVARAFRNLDTACKRNKVRTDFLKQRFHERPGLKRKRIRYEGKIRGFKARFTKVVQMVQSMTKSGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.29
3 0.27
4 0.22
5 0.18
6 0.15
7 0.14
8 0.15
9 0.15
10 0.12
11 0.13
12 0.13
13 0.17
14 0.15
15 0.22
16 0.26
17 0.29
18 0.32
19 0.38
20 0.4
21 0.42
22 0.5
23 0.48
24 0.51
25 0.54
26 0.6
27 0.62
28 0.68
29 0.71
30 0.64
31 0.66
32 0.63
33 0.58
34 0.57
35 0.51
36 0.53
37 0.55
38 0.65
39 0.65
40 0.67
41 0.72
42 0.74
43 0.79
44 0.78
45 0.77
46 0.78
47 0.8
48 0.83
49 0.82
50 0.74
51 0.75
52 0.67
53 0.64
54 0.62
55 0.58
56 0.52
57 0.49
58 0.56
59 0.51
60 0.56
61 0.51
62 0.45
63 0.4
64 0.41
65 0.37