Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6J3MCN6

Protein Details
Accession A0A6J3MCN6    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
39-82GFKWKEKQPRSDDARNRNSDHLERGYRDRSPRRNDYRRDHFDDRBasic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039732  Hub1/Ubl5  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0036211  P:protein modification process  
Amino Acid Sequences RTSRRSSAPCRMDDKPSRARSASPERGEPRSTHAKLSGGFKWKEKQPRSDDARNRNSDHLERGYRDRSPRRNDYRRDHFDDRRDRDGPADDYKRHRDRDSGRERNYDSRPHDGGRDKFLDRERPQRQERSGKDAKDTQDKAKKEKDNNSAPPPPQPPSGEPMIIVNINDRLGTKAAIPCFASDSVKAFKAMVAAHIGRQPHEIMLKRQGERPFKDILTLEDYGVSNGVQLDLELDTGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.67
3 0.66
4 0.66
5 0.61
6 0.6
7 0.59
8 0.61
9 0.62
10 0.56
11 0.59
12 0.58
13 0.61
14 0.61
15 0.53
16 0.49
17 0.5
18 0.47
19 0.42
20 0.4
21 0.38
22 0.38
23 0.43
24 0.42
25 0.39
26 0.4
27 0.41
28 0.45
29 0.49
30 0.56
31 0.57
32 0.6
33 0.59
34 0.67
35 0.71
36 0.75
37 0.76
38 0.76
39 0.8
40 0.76
41 0.72
42 0.66
43 0.63
44 0.56
45 0.52
46 0.48
47 0.43
48 0.4
49 0.43
50 0.42
51 0.42
52 0.48
53 0.52
54 0.54
55 0.58
56 0.66
57 0.71
58 0.76
59 0.8
60 0.81
61 0.82
62 0.82
63 0.82
64 0.79
65 0.75
66 0.75
67 0.77
68 0.72
69 0.68
70 0.61
71 0.53
72 0.47
73 0.45
74 0.39
75 0.37
76 0.36
77 0.33
78 0.38
79 0.47
80 0.5
81 0.49
82 0.46
83 0.46
84 0.48
85 0.55
86 0.6
87 0.61
88 0.59
89 0.61
90 0.62
91 0.62
92 0.58
93 0.55
94 0.47
95 0.43
96 0.41
97 0.37
98 0.39
99 0.39
100 0.37
101 0.34
102 0.34
103 0.29
104 0.31
105 0.33
106 0.37
107 0.33
108 0.42
109 0.43
110 0.48
111 0.52
112 0.54
113 0.58
114 0.58
115 0.57
116 0.56
117 0.56
118 0.49
119 0.48
120 0.47
121 0.44
122 0.43
123 0.43
124 0.43
125 0.45
126 0.46
127 0.48
128 0.52
129 0.56
130 0.54
131 0.6
132 0.61
133 0.62
134 0.67
135 0.68
136 0.66
137 0.6
138 0.59
139 0.53
140 0.47
141 0.42
142 0.38
143 0.32
144 0.3
145 0.32
146 0.25
147 0.22
148 0.2
149 0.18
150 0.16
151 0.14
152 0.12
153 0.1
154 0.1
155 0.1
156 0.1
157 0.1
158 0.1
159 0.11
160 0.12
161 0.14
162 0.15
163 0.17
164 0.17
165 0.16
166 0.18
167 0.19
168 0.18
169 0.15
170 0.18
171 0.18
172 0.19
173 0.19
174 0.16
175 0.15
176 0.17
177 0.16
178 0.14
179 0.16
180 0.16
181 0.17
182 0.2
183 0.2
184 0.19
185 0.21
186 0.2
187 0.17
188 0.23
189 0.25
190 0.27
191 0.36
192 0.42
193 0.42
194 0.47
195 0.53
196 0.56
197 0.57
198 0.55
199 0.51
200 0.44
201 0.47
202 0.42
203 0.37
204 0.34
205 0.3
206 0.27
207 0.24
208 0.24
209 0.2
210 0.2
211 0.16
212 0.1
213 0.1
214 0.1
215 0.07
216 0.06
217 0.07
218 0.07