Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6J3MBW9

Protein Details
Accession A0A6J3MBW9    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
51-81DQTNEAPSKRNRPNPKRRKKSISPTFPPHILHydrophilic
NLS Segment(s)
PositionSequence
58-71SKRNRPNPKRRKKS
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MASETNKPPSNPSASNNNNNNTTSSSNHDEADLAKVSRTQNFPENHIDHRDQTNEAPSKRNRPNPKRRKKSISPTFPPHILQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.57
3 0.58
4 0.57
5 0.53
6 0.51
7 0.48
8 0.41
9 0.37
10 0.29
11 0.29
12 0.3
13 0.28
14 0.27
15 0.25
16 0.22
17 0.2
18 0.21
19 0.17
20 0.11
21 0.1
22 0.13
23 0.14
24 0.18
25 0.19
26 0.18
27 0.23
28 0.24
29 0.27
30 0.31
31 0.32
32 0.31
33 0.34
34 0.33
35 0.29
36 0.3
37 0.28
38 0.23
39 0.22
40 0.28
41 0.29
42 0.29
43 0.34
44 0.36
45 0.44
46 0.51
47 0.59
48 0.63
49 0.68
50 0.78
51 0.82
52 0.9
53 0.91
54 0.92
55 0.93
56 0.92
57 0.92
58 0.92
59 0.91
60 0.89
61 0.87
62 0.83