Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6J3M4C1

Protein Details
Accession A0A6J3M4C1    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
84-109ALRDDWHQQKKSKRKRDSNSPEGTCFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 10.5, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
Amino Acid Sequences MAAKRKRGIAQSVTSTSARKRTRVQKNDLSSPTPHDQIEGEPVYRARSIIDENKTYYKIDWEDDPITGERYDPTWEPKANANQALRDDWHQQKKSKRKRDSNSPEGTCFVYSADSQFLQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.44
3 0.4
4 0.42
5 0.39
6 0.37
7 0.43
8 0.5
9 0.6
10 0.67
11 0.72
12 0.72
13 0.75
14 0.8
15 0.74
16 0.67
17 0.57
18 0.55
19 0.49
20 0.42
21 0.35
22 0.26
23 0.23
24 0.21
25 0.25
26 0.2
27 0.16
28 0.15
29 0.16
30 0.16
31 0.16
32 0.15
33 0.09
34 0.1
35 0.13
36 0.19
37 0.22
38 0.22
39 0.24
40 0.27
41 0.27
42 0.26
43 0.22
44 0.19
45 0.16
46 0.16
47 0.14
48 0.16
49 0.16
50 0.15
51 0.17
52 0.14
53 0.14
54 0.13
55 0.12
56 0.09
57 0.09
58 0.11
59 0.1
60 0.15
61 0.18
62 0.19
63 0.21
64 0.26
65 0.31
66 0.33
67 0.38
68 0.34
69 0.32
70 0.33
71 0.34
72 0.3
73 0.27
74 0.3
75 0.33
76 0.42
77 0.44
78 0.49
79 0.57
80 0.66
81 0.74
82 0.78
83 0.8
84 0.81
85 0.85
86 0.9
87 0.91
88 0.9
89 0.89
90 0.83
91 0.75
92 0.66
93 0.58
94 0.47
95 0.37
96 0.28
97 0.2
98 0.16
99 0.15
100 0.17