Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6J3LXY9

Protein Details
Accession A0A6J3LXY9    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
20-39VWNNHIKKWFRKDTKHLVHDHydrophilic
NLS Segment(s)
PositionSequence
95-103KRFAKYKRR
Subcellular Location(s) cyto 20, nucl 3, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR000266  Ribosomal_S17/S11  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00366  Ribosomal_S17  
Amino Acid Sequences VVISAGLMDRTVTVRLPGQVWNNHIKKWFRKDTKHLVHDPNNSLVTGDVIELHAEQHTKHVAYVVGAIVSPFGKPIEERPPVPTADDRLAAYKEKRFAKYKRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.16
4 0.2
5 0.24
6 0.27
7 0.31
8 0.39
9 0.39
10 0.39
11 0.45
12 0.47
13 0.49
14 0.55
15 0.61
16 0.6
17 0.66
18 0.72
19 0.77
20 0.8
21 0.79
22 0.76
23 0.73
24 0.72
25 0.69
26 0.63
27 0.56
28 0.46
29 0.39
30 0.32
31 0.24
32 0.17
33 0.11
34 0.08
35 0.05
36 0.04
37 0.05
38 0.04
39 0.05
40 0.05
41 0.05
42 0.05
43 0.07
44 0.08
45 0.08
46 0.08
47 0.09
48 0.09
49 0.09
50 0.1
51 0.08
52 0.06
53 0.06
54 0.06
55 0.06
56 0.06
57 0.05
58 0.05
59 0.05
60 0.05
61 0.06
62 0.11
63 0.2
64 0.24
65 0.25
66 0.29
67 0.31
68 0.31
69 0.34
70 0.32
71 0.28
72 0.27
73 0.28
74 0.25
75 0.25
76 0.27
77 0.29
78 0.31
79 0.32
80 0.36
81 0.41
82 0.46
83 0.52