Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q8SUA3

Protein Details
Accession Q8SUA3    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
22-42IPSVHRRKMKKMKVISNKYQIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 12, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR007175  Rpr2/Snm1/Rpp21  
Gene Ontology GO:1902555  C:endoribonuclease complex  
GO:1990904  C:ribonucleoprotein complex  
GO:0034470  P:ncRNA processing  
KEGG ecu:ECU10_1695  -  
Pfam View protein in Pfam  
PF04032  Rpr2  
Amino Acid Sequences MKKDFAKHLKYLYSTALETVEIPSVHRRKMKKMKVISNKYQIRLSREIKRTTCPNCCSILVPGLNCRSRIVKEENGLCLRTTCRCGGEKIFVAQGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.29
3 0.24
4 0.19
5 0.17
6 0.15
7 0.14
8 0.11
9 0.12
10 0.2
11 0.23
12 0.27
13 0.32
14 0.34
15 0.42
16 0.53
17 0.61
18 0.61
19 0.67
20 0.73
21 0.78
22 0.83
23 0.81
24 0.8
25 0.76
26 0.69
27 0.65
28 0.57
29 0.52
30 0.51
31 0.48
32 0.47
33 0.48
34 0.51
35 0.48
36 0.49
37 0.51
38 0.49
39 0.51
40 0.45
41 0.42
42 0.39
43 0.38
44 0.35
45 0.29
46 0.29
47 0.23
48 0.21
49 0.22
50 0.26
51 0.26
52 0.26
53 0.26
54 0.24
55 0.24
56 0.29
57 0.31
58 0.31
59 0.35
60 0.38
61 0.43
62 0.43
63 0.42
64 0.37
65 0.32
66 0.29
67 0.28
68 0.28
69 0.24
70 0.25
71 0.27
72 0.31
73 0.34
74 0.39
75 0.38
76 0.37