Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6J3MHC5

Protein Details
Accession A0A6J3MHC5    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
36-86SLFTQEQKERKKERKKERKKERKKERKKERKKERKKERKKKKQYEIETGLDBasic
NLS Segment(s)
PositionSequence
43-77KERKKERKKERKKERKKERKKERKKERKKERKKKK
Subcellular Location(s) mito 15, nucl 9, cyto 2
Family & Domain DBs
Amino Acid Sequences MMIFSLVSSSAKAPLSLRFFSLTHTLFWLLSKGTFSLFTQEQKERKKERKKERKKERKKERKKERKKERKKERKKKKQYEIETGLDFISTNNNNNHDDNNDSNRKNMGHSTGFMSEKREIKRSIWVYIYIFFEEESI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.26
3 0.26
4 0.27
5 0.26
6 0.25
7 0.27
8 0.33
9 0.27
10 0.22
11 0.23
12 0.22
13 0.2
14 0.2
15 0.18
16 0.12
17 0.12
18 0.12
19 0.1
20 0.1
21 0.11
22 0.11
23 0.14
24 0.16
25 0.18
26 0.23
27 0.29
28 0.35
29 0.41
30 0.5
31 0.54
32 0.62
33 0.7
34 0.75
35 0.8
36 0.84
37 0.89
38 0.91
39 0.93
40 0.95
41 0.95
42 0.96
43 0.96
44 0.96
45 0.96
46 0.96
47 0.96
48 0.96
49 0.96
50 0.96
51 0.96
52 0.96
53 0.96
54 0.96
55 0.96
56 0.96
57 0.96
58 0.96
59 0.96
60 0.96
61 0.96
62 0.96
63 0.95
64 0.94
65 0.89
66 0.88
67 0.83
68 0.75
69 0.64
70 0.54
71 0.43
72 0.32
73 0.25
74 0.15
75 0.14
76 0.11
77 0.14
78 0.16
79 0.19
80 0.21
81 0.22
82 0.23
83 0.2
84 0.23
85 0.24
86 0.3
87 0.35
88 0.33
89 0.34
90 0.35
91 0.34
92 0.33
93 0.32
94 0.29
95 0.24
96 0.25
97 0.28
98 0.29
99 0.31
100 0.29
101 0.31
102 0.31
103 0.34
104 0.37
105 0.39
106 0.37
107 0.36
108 0.46
109 0.45
110 0.45
111 0.41
112 0.41
113 0.37
114 0.38
115 0.39
116 0.3
117 0.27