Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6J3M829

Protein Details
Accession A0A6J3M829    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
53-82GKYHKIRFFDRQKATRRLKKAKKELRAYEGBasic
NLS Segment(s)
PositionSequence
63-76RQKATRRLKKAKKE
176-200AAKRKDENSSSNKGAKSSRPGKVKD
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019310  Efg1  
Gene Ontology GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF10153  Efg1  
Amino Acid Sequences NELKSKIRSLKRLLDRNDDLPADVRVEKERALQSAQHDLDIANRVHQRSEMIGKYHKIRFFDRQKATRRLKKAKKELRAYEGGDAEERARLGRAVDEAETELNYAQFYPLEKAYVPLFPTKKNIKDDEDGDGEGSGAKEVERVGDPEMWKRIQKCMKDGTLDALREGRLEGSRPIAAKRKDENSSSNKGAKSSRPGKVKDAKTIGKVEKTTNVRNTRDEPQDEDDDSDGGFFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.72
3 0.67
4 0.64
5 0.55
6 0.46
7 0.38
8 0.34
9 0.27
10 0.23
11 0.22
12 0.2
13 0.21
14 0.21
15 0.26
16 0.27
17 0.26
18 0.28
19 0.29
20 0.29
21 0.37
22 0.36
23 0.3
24 0.27
25 0.25
26 0.25
27 0.27
28 0.24
29 0.2
30 0.23
31 0.24
32 0.24
33 0.25
34 0.23
35 0.22
36 0.28
37 0.26
38 0.26
39 0.3
40 0.33
41 0.39
42 0.43
43 0.42
44 0.39
45 0.4
46 0.46
47 0.51
48 0.58
49 0.61
50 0.63
51 0.69
52 0.75
53 0.81
54 0.79
55 0.8
56 0.81
57 0.82
58 0.84
59 0.86
60 0.86
61 0.85
62 0.86
63 0.82
64 0.78
65 0.73
66 0.64
67 0.57
68 0.48
69 0.39
70 0.3
71 0.24
72 0.18
73 0.13
74 0.12
75 0.08
76 0.07
77 0.07
78 0.07
79 0.07
80 0.08
81 0.08
82 0.08
83 0.08
84 0.09
85 0.09
86 0.08
87 0.08
88 0.07
89 0.06
90 0.05
91 0.05
92 0.04
93 0.05
94 0.05
95 0.07
96 0.07
97 0.08
98 0.08
99 0.09
100 0.1
101 0.11
102 0.11
103 0.15
104 0.16
105 0.16
106 0.23
107 0.27
108 0.31
109 0.34
110 0.36
111 0.35
112 0.37
113 0.38
114 0.35
115 0.32
116 0.27
117 0.22
118 0.19
119 0.14
120 0.11
121 0.1
122 0.06
123 0.04
124 0.04
125 0.04
126 0.04
127 0.06
128 0.06
129 0.07
130 0.09
131 0.12
132 0.13
133 0.17
134 0.2
135 0.21
136 0.23
137 0.23
138 0.3
139 0.34
140 0.36
141 0.38
142 0.41
143 0.42
144 0.42
145 0.41
146 0.38
147 0.37
148 0.34
149 0.3
150 0.25
151 0.22
152 0.19
153 0.19
154 0.15
155 0.1
156 0.12
157 0.12
158 0.14
159 0.16
160 0.17
161 0.21
162 0.27
163 0.3
164 0.35
165 0.4
166 0.43
167 0.46
168 0.49
169 0.53
170 0.51
171 0.55
172 0.53
173 0.53
174 0.47
175 0.45
176 0.46
177 0.43
178 0.46
179 0.48
180 0.51
181 0.53
182 0.56
183 0.62
184 0.68
185 0.67
186 0.67
187 0.66
188 0.63
189 0.61
190 0.66
191 0.62
192 0.59
193 0.56
194 0.5
195 0.5
196 0.52
197 0.55
198 0.56
199 0.59
200 0.56
201 0.6
202 0.62
203 0.61
204 0.63
205 0.58
206 0.54
207 0.52
208 0.53
209 0.48
210 0.45
211 0.38
212 0.3
213 0.27