Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6J3MHU8

Protein Details
Accession A0A6J3MHU8    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
104-125DGDPRDKKSRARREKYPNNFDVBasic
NLS Segment(s)
PositionSequence
110-115KKSRAR
Subcellular Location(s) mito 16.5, mito_nucl 12.833, nucl 8, cyto_nucl 5.333
Family & Domain DBs
Amino Acid Sequences MSKQSRVARATKVDRPSTSSSMSLAPPFALAEERHEILRSMAKVIDGRHRLWHEHNLNDLEDEVYARIELHLAMLGILKRKPVKPNNGPSDSDDSTDSNKNPPDGDPRDKKSRARREKYPNNFDVHTRIWRYEDKAEWSDEMLVAKAESGRDLRSDPLFFVFNAAVRSCLACQRIALEQLDARRVQRDGLHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.6
3 0.59
4 0.54
5 0.5
6 0.43
7 0.36
8 0.32
9 0.33
10 0.27
11 0.21
12 0.17
13 0.14
14 0.13
15 0.12
16 0.12
17 0.11
18 0.14
19 0.18
20 0.19
21 0.19
22 0.19
23 0.19
24 0.18
25 0.23
26 0.19
27 0.17
28 0.16
29 0.17
30 0.19
31 0.21
32 0.28
33 0.27
34 0.27
35 0.33
36 0.34
37 0.36
38 0.38
39 0.46
40 0.42
41 0.41
42 0.44
43 0.39
44 0.37
45 0.34
46 0.3
47 0.2
48 0.15
49 0.13
50 0.08
51 0.06
52 0.06
53 0.05
54 0.05
55 0.05
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.06
62 0.07
63 0.09
64 0.09
65 0.12
66 0.15
67 0.18
68 0.27
69 0.33
70 0.42
71 0.49
72 0.59
73 0.64
74 0.65
75 0.63
76 0.57
77 0.56
78 0.47
79 0.39
80 0.3
81 0.23
82 0.22
83 0.23
84 0.2
85 0.17
86 0.17
87 0.16
88 0.16
89 0.16
90 0.22
91 0.26
92 0.33
93 0.37
94 0.42
95 0.5
96 0.53
97 0.59
98 0.61
99 0.66
100 0.69
101 0.69
102 0.73
103 0.76
104 0.83
105 0.86
106 0.84
107 0.77
108 0.7
109 0.64
110 0.56
111 0.5
112 0.43
113 0.39
114 0.32
115 0.28
116 0.28
117 0.3
118 0.33
119 0.33
120 0.33
121 0.33
122 0.33
123 0.33
124 0.3
125 0.28
126 0.25
127 0.2
128 0.17
129 0.12
130 0.1
131 0.08
132 0.08
133 0.08
134 0.07
135 0.08
136 0.09
137 0.1
138 0.12
139 0.13
140 0.16
141 0.19
142 0.19
143 0.18
144 0.2
145 0.2
146 0.18
147 0.19
148 0.17
149 0.15
150 0.17
151 0.16
152 0.14
153 0.14
154 0.16
155 0.14
156 0.19
157 0.19
158 0.17
159 0.17
160 0.19
161 0.22
162 0.24
163 0.24
164 0.22
165 0.23
166 0.26
167 0.3
168 0.29
169 0.27
170 0.27
171 0.27
172 0.27