Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6J3M783

Protein Details
Accession A0A6J3M783    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
9-37NSAYYSRYQVKYKRRRSGKTDYYARKRLIHydrophilic
266-285KKTKEEWKAESKKYRSQKSTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR005485  Rbsml_L5_euk/L18_arc  
IPR025607  Rbsml_L5e_C  
Gene Ontology GO:0005737  C:cytoplasm  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0008097  F:5S rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF14204  Ribosomal_L18_c  
PF17144  Ribosomal_L5e  
CDD cd00432  Ribosomal_L18_L5e  
Amino Acid Sequences MPFTKLVKNSAYYSRYQVKYKRRRSGKTDYYARKRLITQAKNKYNAPKYRLVIRFTNRDIIAQIVTSEINGDKVFCAAYGHELKRYGVTHGLTNWAAAYCVGLLLARRTLSKLKLDEAFTGVEEADGEYKITEEEEVDGESRRPFKAYLDVGLTRTSTGARVFGAMKGASDGGLHIPHSEKRFPGYDIESKELDAETLRKYIFAGHVAEYMETLADDDEERYKSQFQGYIDDEIEADGLEELYTDAHKQIREDPWLKADDEDEGEKKTKEEWKAESKKYRSQKSTLEERRERVAKKIQAIVAEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.5
3 0.54
4 0.58
5 0.61
6 0.68
7 0.76
8 0.8
9 0.81
10 0.85
11 0.85
12 0.88
13 0.87
14 0.86
15 0.86
16 0.86
17 0.86
18 0.85
19 0.79
20 0.72
21 0.64
22 0.63
23 0.63
24 0.62
25 0.63
26 0.66
27 0.72
28 0.72
29 0.75
30 0.75
31 0.74
32 0.73
33 0.68
34 0.66
35 0.6
36 0.65
37 0.66
38 0.61
39 0.6
40 0.58
41 0.6
42 0.54
43 0.58
44 0.49
45 0.44
46 0.4
47 0.33
48 0.28
49 0.2
50 0.17
51 0.1
52 0.1
53 0.09
54 0.09
55 0.07
56 0.08
57 0.08
58 0.08
59 0.07
60 0.08
61 0.08
62 0.07
63 0.08
64 0.06
65 0.12
66 0.19
67 0.2
68 0.23
69 0.24
70 0.25
71 0.28
72 0.28
73 0.24
74 0.21
75 0.21
76 0.2
77 0.19
78 0.23
79 0.19
80 0.18
81 0.17
82 0.12
83 0.11
84 0.09
85 0.09
86 0.04
87 0.04
88 0.04
89 0.04
90 0.05
91 0.06
92 0.07
93 0.08
94 0.08
95 0.11
96 0.14
97 0.17
98 0.22
99 0.22
100 0.24
101 0.27
102 0.29
103 0.27
104 0.25
105 0.23
106 0.17
107 0.16
108 0.13
109 0.09
110 0.07
111 0.06
112 0.05
113 0.05
114 0.05
115 0.04
116 0.04
117 0.05
118 0.05
119 0.04
120 0.04
121 0.05
122 0.05
123 0.06
124 0.06
125 0.07
126 0.08
127 0.09
128 0.11
129 0.1
130 0.11
131 0.11
132 0.11
133 0.17
134 0.17
135 0.17
136 0.19
137 0.2
138 0.2
139 0.2
140 0.19
141 0.13
142 0.12
143 0.1
144 0.08
145 0.07
146 0.07
147 0.06
148 0.08
149 0.08
150 0.08
151 0.1
152 0.09
153 0.08
154 0.08
155 0.08
156 0.07
157 0.06
158 0.06
159 0.05
160 0.06
161 0.06
162 0.06
163 0.08
164 0.11
165 0.14
166 0.16
167 0.15
168 0.17
169 0.19
170 0.2
171 0.22
172 0.24
173 0.26
174 0.27
175 0.3
176 0.27
177 0.25
178 0.25
179 0.21
180 0.16
181 0.12
182 0.11
183 0.09
184 0.11
185 0.11
186 0.11
187 0.11
188 0.13
189 0.14
190 0.14
191 0.15
192 0.13
193 0.15
194 0.16
195 0.15
196 0.13
197 0.12
198 0.09
199 0.07
200 0.06
201 0.04
202 0.04
203 0.05
204 0.06
205 0.08
206 0.1
207 0.11
208 0.12
209 0.14
210 0.15
211 0.17
212 0.2
213 0.18
214 0.23
215 0.24
216 0.26
217 0.25
218 0.24
219 0.22
220 0.18
221 0.17
222 0.1
223 0.08
224 0.04
225 0.04
226 0.04
227 0.04
228 0.04
229 0.04
230 0.05
231 0.06
232 0.08
233 0.11
234 0.12
235 0.13
236 0.21
237 0.26
238 0.34
239 0.36
240 0.37
241 0.39
242 0.41
243 0.4
244 0.34
245 0.29
246 0.23
247 0.23
248 0.24
249 0.21
250 0.22
251 0.24
252 0.23
253 0.23
254 0.26
255 0.31
256 0.33
257 0.38
258 0.42
259 0.51
260 0.6
261 0.69
262 0.74
263 0.73
264 0.76
265 0.79
266 0.82
267 0.77
268 0.74
269 0.74
270 0.72
271 0.77
272 0.77
273 0.78
274 0.75
275 0.72
276 0.75
277 0.74
278 0.67
279 0.64
280 0.65
281 0.61
282 0.6
283 0.64
284 0.57