Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6J3LZE1

Protein Details
Accession A0A6J3LZE1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
5-26NVSGIRCCRHCRRRLYYKAYLDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 27
Family & Domain DBs
Amino Acid Sequences MITSNVSGIRCCRHCRRRLYYKAYLDILAPAYYLQFIGLRHYGDTLNVTSSRRPFRYVTGQVGREEEVHVLYVSCVQSRLRW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.67
3 0.75
4 0.78
5 0.83
6 0.84
7 0.83
8 0.8
9 0.76
10 0.68
11 0.58
12 0.48
13 0.39
14 0.31
15 0.21
16 0.14
17 0.09
18 0.08
19 0.07
20 0.06
21 0.05
22 0.05
23 0.05
24 0.08
25 0.1
26 0.1
27 0.1
28 0.11
29 0.11
30 0.09
31 0.11
32 0.09
33 0.09
34 0.1
35 0.11
36 0.13
37 0.18
38 0.24
39 0.24
40 0.27
41 0.27
42 0.31
43 0.4
44 0.42
45 0.46
46 0.47
47 0.48
48 0.46
49 0.46
50 0.41
51 0.32
52 0.29
53 0.21
54 0.14
55 0.13
56 0.12
57 0.1
58 0.09
59 0.13
60 0.13
61 0.13
62 0.14