Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6J3MEI0

Protein Details
Accession A0A6J3MEI0    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MASHRLTYRRRQPYNTKSNKVRVVKTHydrophilic
NLS Segment(s)
PositionSequence
104-115KVMKEAEKKSKR
Subcellular Location(s) nucl 11, mito 10, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MASHRLTYRRRQPYNTKSNKVRVVKTPGGELRYLHLKKKGTAPKCGDCGTKLPGIPALRPREYAGVSRPKKTVQRAYGGSRCANCVKDRVVRAFLIEEQKIVKKVMKEAEKKSKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.86
3 0.84
4 0.82
5 0.83
6 0.84
7 0.8
8 0.74
9 0.71
10 0.7
11 0.65
12 0.59
13 0.57
14 0.52
15 0.47
16 0.43
17 0.36
18 0.3
19 0.35
20 0.35
21 0.31
22 0.33
23 0.33
24 0.34
25 0.43
26 0.49
27 0.43
28 0.5
29 0.53
30 0.52
31 0.54
32 0.54
33 0.45
34 0.38
35 0.37
36 0.31
37 0.27
38 0.22
39 0.18
40 0.2
41 0.2
42 0.2
43 0.24
44 0.26
45 0.24
46 0.25
47 0.25
48 0.24
49 0.24
50 0.24
51 0.24
52 0.29
53 0.3
54 0.32
55 0.33
56 0.35
57 0.4
58 0.45
59 0.48
60 0.42
61 0.47
62 0.49
63 0.55
64 0.55
65 0.52
66 0.48
67 0.4
68 0.39
69 0.35
70 0.33
71 0.27
72 0.27
73 0.28
74 0.32
75 0.35
76 0.37
77 0.37
78 0.34
79 0.34
80 0.33
81 0.33
82 0.32
83 0.28
84 0.24
85 0.25
86 0.28
87 0.28
88 0.28
89 0.27
90 0.23
91 0.3
92 0.38
93 0.44
94 0.49
95 0.57