Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q8SS18

Protein Details
Accession Q8SS18    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
14-45IKEAYRKNKKFIRHHSDRYKRVKPSWRRPHGIBasic
NLS Segment(s)
PositionSequence
19-72RKNKKFIRHHSDRYKRVKPSWRRPHGIDSKVRKRCKGEREMPSIKYKKPKEIRH
Subcellular Location(s) nucl 19.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ecu:ECU04_1310  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MSSELFDPKPLVEIKEAYRKNKKFIRHHSDRYKRVKPSWRRPHGIDSKVRKRCKGEREMPSIKYKKPKEIRHLLPNGLRKVRIFNINDLTPLTSLNRFYCGEIAHAVGARKRIAIVNRAKELGICLLNGNARLIPEIEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.36
3 0.41
4 0.45
5 0.55
6 0.56
7 0.61
8 0.63
9 0.68
10 0.68
11 0.74
12 0.76
13 0.75
14 0.82
15 0.85
16 0.89
17 0.89
18 0.88
19 0.85
20 0.82
21 0.8
22 0.8
23 0.8
24 0.81
25 0.83
26 0.82
27 0.79
28 0.76
29 0.78
30 0.77
31 0.73
32 0.71
33 0.7
34 0.71
35 0.74
36 0.74
37 0.69
38 0.66
39 0.68
40 0.68
41 0.68
42 0.66
43 0.66
44 0.71
45 0.71
46 0.67
47 0.69
48 0.63
49 0.57
50 0.57
51 0.51
52 0.51
53 0.56
54 0.6
55 0.59
56 0.65
57 0.68
58 0.67
59 0.69
60 0.62
61 0.59
62 0.57
63 0.53
64 0.45
65 0.4
66 0.31
67 0.32
68 0.31
69 0.33
70 0.28
71 0.28
72 0.31
73 0.3
74 0.31
75 0.27
76 0.25
77 0.17
78 0.17
79 0.14
80 0.11
81 0.12
82 0.12
83 0.16
84 0.15
85 0.16
86 0.17
87 0.16
88 0.16
89 0.15
90 0.15
91 0.12
92 0.13
93 0.14
94 0.14
95 0.16
96 0.15
97 0.14
98 0.15
99 0.18
100 0.2
101 0.28
102 0.35
103 0.4
104 0.43
105 0.44
106 0.42
107 0.38
108 0.37
109 0.33
110 0.25
111 0.18
112 0.15
113 0.16
114 0.18
115 0.19
116 0.18
117 0.14
118 0.14
119 0.15