Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6J3MG41

Protein Details
Accession A0A6J3MG41    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
21-46RDCYDENKKKRKGKESSTKRDRWREMBasic
NLS Segment(s)
PositionSequence
28-40KKKRKGKESSTKR
Subcellular Location(s) mito 14, plas 6, cyto 5
Family & Domain DBs
Amino Acid Sequences MCVPHARVPLKRSIASHRVDRDCYDENKKKRKGKESSTKRDRWREMYMCVCAPPFLSTKATTTLAVLRRCVVVAVVIFTTYYSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.51
3 0.55
4 0.54
5 0.53
6 0.52
7 0.5
8 0.47
9 0.44
10 0.46
11 0.48
12 0.49
13 0.54
14 0.61
15 0.69
16 0.7
17 0.74
18 0.78
19 0.77
20 0.78
21 0.8
22 0.81
23 0.83
24 0.85
25 0.85
26 0.83
27 0.83
28 0.76
29 0.7
30 0.67
31 0.59
32 0.54
33 0.5
34 0.44
35 0.36
36 0.33
37 0.27
38 0.19
39 0.17
40 0.14
41 0.12
42 0.12
43 0.14
44 0.15
45 0.16
46 0.2
47 0.21
48 0.19
49 0.19
50 0.22
51 0.26
52 0.27
53 0.27
54 0.24
55 0.23
56 0.23
57 0.22
58 0.16
59 0.12
60 0.11
61 0.12
62 0.11
63 0.1
64 0.1