Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6J3MDS2

Protein Details
Accession A0A6J3MDS2    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAIENKDKKSKRPSKRKSQTLDTPDHPHydrophilic
NLS Segment(s)
PositionSequence
7-17DKKSKRPSKRK
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR028217  Rsa3_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF14615  Rsa3  
Amino Acid Sequences MAIENKDKKSKRPSKRKSQTLDTPDHPSQIQDEQEESILPKSSQGKGAQPIALTQAEEVTAEQKFAAFYLRQTTQEFADDLDKLRTASDFNDRSVELLVDSLQKGTACFAKSDRVRIGRAGAET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.91
3 0.93
4 0.9
5 0.89
6 0.88
7 0.84
8 0.81
9 0.73
10 0.7
11 0.61
12 0.55
13 0.46
14 0.36
15 0.31
16 0.28
17 0.26
18 0.19
19 0.19
20 0.17
21 0.17
22 0.17
23 0.15
24 0.12
25 0.12
26 0.1
27 0.13
28 0.16
29 0.17
30 0.21
31 0.22
32 0.24
33 0.27
34 0.29
35 0.27
36 0.23
37 0.22
38 0.2
39 0.19
40 0.15
41 0.11
42 0.08
43 0.07
44 0.07
45 0.07
46 0.06
47 0.05
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.07
54 0.06
55 0.06
56 0.11
57 0.13
58 0.15
59 0.16
60 0.17
61 0.16
62 0.17
63 0.16
64 0.13
65 0.13
66 0.12
67 0.12
68 0.12
69 0.12
70 0.11
71 0.11
72 0.1
73 0.09
74 0.11
75 0.19
76 0.19
77 0.2
78 0.22
79 0.22
80 0.22
81 0.22
82 0.2
83 0.11
84 0.1
85 0.1
86 0.1
87 0.1
88 0.1
89 0.1
90 0.1
91 0.1
92 0.12
93 0.15
94 0.14
95 0.16
96 0.17
97 0.26
98 0.29
99 0.35
100 0.41
101 0.41
102 0.43
103 0.43
104 0.46