Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6J3MBD7

Protein Details
Accession A0A6J3MBD7    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
213-232SSRPNRHTNHSKRTDTRPSTHydrophilic
NLS Segment(s)
PositionSequence
285-286KR
Subcellular Location(s) nucl 20, cyto_nucl 14, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR029196  HAPSTR1-like  
Pfam View protein in Pfam  
PF15251  DUF4588  
Amino Acid Sequences MDSMRHLSTSLPQTSRQQNDRTVDLLPDFKQAALSVTNLYKAADQAQRRARTAGYQDALEDILTFLDRENLGLMDGEGWRVRQWATQNLDGTSAARSTTDDDGDERASNNKDEEKEEETCSSPEAARQASSEDQDSLRRRVVSEPPQVQTIEIQHSPPRGDFTFVSQHAFPSNHERNASSPGMELDTTSGSTPIFAQSSIPSGADIVRQAPRSSRPNRHTNHSKRTDTRPSTLNFNLGNGAGSKRKLPYSDFFDISGFGEGTDRKDGASGGAGSGGSPHSSRGGKRGRHV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.59
3 0.58
4 0.56
5 0.57
6 0.59
7 0.58
8 0.52
9 0.44
10 0.39
11 0.34
12 0.33
13 0.26
14 0.26
15 0.23
16 0.22
17 0.21
18 0.19
19 0.18
20 0.15
21 0.15
22 0.15
23 0.15
24 0.16
25 0.16
26 0.16
27 0.14
28 0.14
29 0.19
30 0.23
31 0.24
32 0.32
33 0.4
34 0.44
35 0.45
36 0.46
37 0.41
38 0.4
39 0.42
40 0.42
41 0.35
42 0.3
43 0.29
44 0.28
45 0.27
46 0.21
47 0.16
48 0.08
49 0.06
50 0.06
51 0.06
52 0.05
53 0.08
54 0.08
55 0.08
56 0.09
57 0.08
58 0.09
59 0.09
60 0.08
61 0.07
62 0.07
63 0.08
64 0.08
65 0.08
66 0.08
67 0.09
68 0.1
69 0.12
70 0.15
71 0.22
72 0.27
73 0.31
74 0.32
75 0.32
76 0.32
77 0.29
78 0.26
79 0.19
80 0.14
81 0.09
82 0.08
83 0.08
84 0.1
85 0.11
86 0.11
87 0.11
88 0.11
89 0.13
90 0.14
91 0.14
92 0.12
93 0.14
94 0.15
95 0.15
96 0.16
97 0.18
98 0.18
99 0.19
100 0.22
101 0.23
102 0.24
103 0.25
104 0.25
105 0.23
106 0.21
107 0.2
108 0.17
109 0.13
110 0.12
111 0.13
112 0.12
113 0.1
114 0.11
115 0.12
116 0.13
117 0.14
118 0.13
119 0.12
120 0.12
121 0.18
122 0.21
123 0.2
124 0.21
125 0.2
126 0.2
127 0.23
128 0.29
129 0.31
130 0.36
131 0.38
132 0.37
133 0.38
134 0.37
135 0.34
136 0.28
137 0.21
138 0.17
139 0.14
140 0.14
141 0.14
142 0.16
143 0.16
144 0.15
145 0.17
146 0.13
147 0.15
148 0.14
149 0.17
150 0.22
151 0.22
152 0.24
153 0.2
154 0.2
155 0.2
156 0.21
157 0.18
158 0.21
159 0.26
160 0.26
161 0.27
162 0.27
163 0.26
164 0.31
165 0.3
166 0.21
167 0.17
168 0.15
169 0.15
170 0.14
171 0.13
172 0.08
173 0.08
174 0.08
175 0.08
176 0.08
177 0.06
178 0.07
179 0.07
180 0.07
181 0.07
182 0.07
183 0.08
184 0.08
185 0.11
186 0.11
187 0.11
188 0.09
189 0.09
190 0.1
191 0.1
192 0.1
193 0.1
194 0.14
195 0.15
196 0.16
197 0.19
198 0.25
199 0.33
200 0.41
201 0.48
202 0.51
203 0.59
204 0.63
205 0.69
206 0.74
207 0.75
208 0.77
209 0.76
210 0.77
211 0.74
212 0.79
213 0.8
214 0.74
215 0.69
216 0.64
217 0.57
218 0.56
219 0.52
220 0.49
221 0.38
222 0.34
223 0.31
224 0.24
225 0.23
226 0.17
227 0.18
228 0.16
229 0.17
230 0.19
231 0.21
232 0.24
233 0.26
234 0.29
235 0.34
236 0.38
237 0.44
238 0.42
239 0.4
240 0.37
241 0.36
242 0.32
243 0.26
244 0.18
245 0.12
246 0.13
247 0.13
248 0.15
249 0.18
250 0.17
251 0.15
252 0.16
253 0.16
254 0.15
255 0.18
256 0.15
257 0.12
258 0.13
259 0.13
260 0.12
261 0.13
262 0.13
263 0.1
264 0.1
265 0.11
266 0.16
267 0.2
268 0.22
269 0.3
270 0.39