Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6J3M2A6

Protein Details
Accession A0A6J3M2A6    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
89-108AKKAAPKKAATKKKPKRVTLBasic
NLS Segment(s)
PositionSequence
74-130TKTAKSTKAAAKKPRAKKAAPKKAATKKKPKRVTLTEEQKAAQKAKLLKRKTSEKKK
Subcellular Location(s) mito 20, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
Amino Acid Sequences MLARLPVSSAGSRLVHCHRHIRRPIVRIVAFHATRTYATPGRPKSVVGEPSKPVKRATSRATGTSTTSAKRTTTKTAKSTKAAAKKPRAKKAAPKKAATKKKPKRVTLTEEQKAAQKAKLLKRKTSEKKKADLLEIKTLKEQALAPPVPVTGNRNAYNVYVAEAMKGAKGSNGDVTSAFAHVAKQYKSLSAAEKEVRKRIEGRLAVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.33
3 0.36
4 0.46
5 0.49
6 0.57
7 0.65
8 0.7
9 0.71
10 0.69
11 0.72
12 0.71
13 0.66
14 0.57
15 0.54
16 0.52
17 0.45
18 0.4
19 0.35
20 0.27
21 0.25
22 0.26
23 0.26
24 0.21
25 0.24
26 0.32
27 0.34
28 0.38
29 0.38
30 0.36
31 0.35
32 0.39
33 0.43
34 0.39
35 0.4
36 0.39
37 0.48
38 0.51
39 0.48
40 0.43
41 0.42
42 0.44
43 0.46
44 0.48
45 0.48
46 0.46
47 0.47
48 0.49
49 0.43
50 0.39
51 0.36
52 0.33
53 0.25
54 0.25
55 0.23
56 0.21
57 0.24
58 0.25
59 0.3
60 0.36
61 0.41
62 0.47
63 0.53
64 0.56
65 0.55
66 0.58
67 0.56
68 0.57
69 0.58
70 0.59
71 0.62
72 0.67
73 0.73
74 0.75
75 0.74
76 0.69
77 0.71
78 0.74
79 0.74
80 0.71
81 0.67
82 0.68
83 0.72
84 0.79
85 0.77
86 0.77
87 0.76
88 0.79
89 0.84
90 0.8
91 0.78
92 0.75
93 0.74
94 0.73
95 0.73
96 0.65
97 0.58
98 0.53
99 0.48
100 0.43
101 0.37
102 0.27
103 0.22
104 0.26
105 0.33
106 0.41
107 0.41
108 0.44
109 0.49
110 0.59
111 0.66
112 0.7
113 0.72
114 0.7
115 0.72
116 0.73
117 0.7
118 0.67
119 0.63
120 0.56
121 0.55
122 0.51
123 0.46
124 0.4
125 0.38
126 0.31
127 0.25
128 0.22
129 0.15
130 0.21
131 0.2
132 0.19
133 0.19
134 0.19
135 0.18
136 0.18
137 0.19
138 0.17
139 0.23
140 0.24
141 0.25
142 0.26
143 0.25
144 0.26
145 0.22
146 0.18
147 0.14
148 0.13
149 0.12
150 0.12
151 0.12
152 0.1
153 0.11
154 0.09
155 0.08
156 0.09
157 0.1
158 0.15
159 0.15
160 0.15
161 0.15
162 0.17
163 0.16
164 0.16
165 0.15
166 0.1
167 0.11
168 0.13
169 0.19
170 0.18
171 0.21
172 0.22
173 0.23
174 0.26
175 0.28
176 0.31
177 0.29
178 0.34
179 0.37
180 0.44
181 0.48
182 0.52
183 0.52
184 0.5
185 0.5
186 0.51
187 0.54