Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6J3MGU6

Protein Details
Accession A0A6J3MGU6    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
91-113ATAKSTGKRGRKPKDAQQPAKTGHydrophilic
NLS Segment(s)
PositionSequence
87-104NGKKATAKSTGKRGRKPK
Subcellular Location(s) cyto 12.5, cyto_nucl 12, nucl 10.5, mito 1, plas 1, pero 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MAEKRIKSEQTFDYDTVTAIIYCMLKDGVVLGARHYETMSALSGTRTASAFQHDFRDVKRRAKDLLDKGDVLGPKNKDDDNSTELKNGKKATAKSTGKRGRKPKDAQQPAKTGGFDENETMDENANKKIKLET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.33
3 0.27
4 0.22
5 0.15
6 0.1
7 0.12
8 0.08
9 0.08
10 0.08
11 0.08
12 0.07
13 0.07
14 0.07
15 0.08
16 0.1
17 0.11
18 0.1
19 0.14
20 0.14
21 0.14
22 0.14
23 0.11
24 0.09
25 0.1
26 0.1
27 0.08
28 0.08
29 0.08
30 0.09
31 0.09
32 0.09
33 0.08
34 0.08
35 0.08
36 0.12
37 0.14
38 0.14
39 0.17
40 0.18
41 0.19
42 0.19
43 0.28
44 0.28
45 0.34
46 0.37
47 0.36
48 0.37
49 0.41
50 0.47
51 0.44
52 0.47
53 0.42
54 0.37
55 0.35
56 0.36
57 0.31
58 0.25
59 0.23
60 0.17
61 0.17
62 0.19
63 0.19
64 0.17
65 0.19
66 0.22
67 0.21
68 0.23
69 0.22
70 0.24
71 0.26
72 0.27
73 0.28
74 0.25
75 0.25
76 0.27
77 0.29
78 0.3
79 0.39
80 0.44
81 0.45
82 0.54
83 0.6
84 0.63
85 0.7
86 0.75
87 0.73
88 0.77
89 0.8
90 0.79
91 0.81
92 0.83
93 0.84
94 0.81
95 0.78
96 0.73
97 0.68
98 0.58
99 0.49
100 0.42
101 0.35
102 0.28
103 0.23
104 0.2
105 0.18
106 0.2
107 0.19
108 0.16
109 0.17
110 0.18
111 0.23
112 0.26
113 0.26