Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6J3M4T3

Protein Details
Accession A0A6J3M4T3    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
87-108EASPAKTTPRKRTKKVDSEIKVHydrophilic
NLS Segment(s)
PositionSequence
93-101TTPRKRTKK
Subcellular Location(s) nucl 18, cyto 5, mito 2
Family & Domain DBs
Amino Acid Sequences MVIWNDSPDRQLLMTMIHLTPEEKSGKQWEVVAKRMGEGFTAEATRQHYQKLRLEYTNANGEQNDSTRGASKAKAGKAGNKAEQSDEASPAKTTPRKRTKKVDSEIKVEKGGSGDGDHELPSASPKKKVKSEH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.15
4 0.14
5 0.14
6 0.14
7 0.14
8 0.17
9 0.18
10 0.15
11 0.18
12 0.23
13 0.24
14 0.25
15 0.28
16 0.31
17 0.33
18 0.37
19 0.38
20 0.32
21 0.31
22 0.31
23 0.28
24 0.2
25 0.17
26 0.13
27 0.1
28 0.11
29 0.1
30 0.11
31 0.15
32 0.17
33 0.17
34 0.2
35 0.22
36 0.27
37 0.33
38 0.37
39 0.37
40 0.36
41 0.38
42 0.36
43 0.35
44 0.36
45 0.31
46 0.25
47 0.21
48 0.21
49 0.18
50 0.17
51 0.15
52 0.1
53 0.1
54 0.11
55 0.12
56 0.12
57 0.12
58 0.16
59 0.2
60 0.2
61 0.26
62 0.25
63 0.31
64 0.37
65 0.41
66 0.41
67 0.38
68 0.38
69 0.33
70 0.33
71 0.31
72 0.25
73 0.23
74 0.19
75 0.17
76 0.17
77 0.16
78 0.21
79 0.24
80 0.3
81 0.37
82 0.47
83 0.56
84 0.64
85 0.74
86 0.78
87 0.82
88 0.85
89 0.85
90 0.79
91 0.77
92 0.77
93 0.69
94 0.6
95 0.5
96 0.41
97 0.31
98 0.27
99 0.2
100 0.14
101 0.12
102 0.12
103 0.13
104 0.12
105 0.11
106 0.11
107 0.1
108 0.15
109 0.22
110 0.23
111 0.31
112 0.37
113 0.45