Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6J3LZ78

Protein Details
Accession A0A6J3LZ78    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
14-36LYRQCLRAARKKPAEKRPHFERFHydrophilic
NLS Segment(s)
PositionSequence
23-31RKKPAEKRP
Subcellular Location(s) mito 14.5, mito_nucl 12, nucl 8.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR008011  Complex1_LYR_dom  
IPR045295  Complex1_LYR_SDHAF1_LYRM8  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0034553  P:mitochondrial respiratory chain complex II assembly  
Pfam View protein in Pfam  
PF05347  Complex1_LYR  
CDD cd20268  Complex1_LYR_SDHAF1_LYRM8  
Amino Acid Sequences MARLSGLQRDVLGLYRQCLRAARKKPAEKRPHFERFARHEFDKNIAMDKKDFSTIEFLLRKGNRQLEIYSAPNITDIAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.22
3 0.23
4 0.23
5 0.28
6 0.32
7 0.37
8 0.43
9 0.52
10 0.57
11 0.65
12 0.73
13 0.79
14 0.83
15 0.81
16 0.81
17 0.8
18 0.79
19 0.74
20 0.68
21 0.65
22 0.62
23 0.61
24 0.58
25 0.5
26 0.45
27 0.42
28 0.41
29 0.36
30 0.29
31 0.27
32 0.24
33 0.24
34 0.22
35 0.22
36 0.2
37 0.19
38 0.19
39 0.15
40 0.18
41 0.17
42 0.23
43 0.23
44 0.22
45 0.28
46 0.29
47 0.31
48 0.33
49 0.38
50 0.34
51 0.35
52 0.36
53 0.33
54 0.37
55 0.36
56 0.32
57 0.28
58 0.25
59 0.23