Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6J3M2V2

Protein Details
Accession A0A6J3M2V2    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
11-38RTSSERRAPKHKVTTSRPRKKAARASSPHydrophilic
NLS Segment(s)
PositionSequence
16-34RRAPKHKVTTSRPRKKAAR
Subcellular Location(s) nucl 16.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MSNTATATIMRTSSERRAPKHKVTTSRPRKKAARASSPSSTQPSSSSISTPRLTPDPTSCDQASQSKRFLTSEESGRDFVEAMTAASDRFDEMEQMAQILGGPGGDDLQLYRMHAELMLREPGQHDGINHCEECVHRGPASHRGLALSELEMERLKASGWSVANRPHQKDVGAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.39
3 0.43
4 0.53
5 0.6
6 0.67
7 0.73
8 0.73
9 0.74
10 0.77
11 0.82
12 0.84
13 0.87
14 0.83
15 0.82
16 0.81
17 0.81
18 0.82
19 0.8
20 0.8
21 0.76
22 0.76
23 0.72
24 0.68
25 0.62
26 0.57
27 0.48
28 0.38
29 0.33
30 0.29
31 0.27
32 0.24
33 0.22
34 0.21
35 0.25
36 0.25
37 0.24
38 0.23
39 0.23
40 0.24
41 0.24
42 0.25
43 0.26
44 0.27
45 0.31
46 0.28
47 0.26
48 0.27
49 0.32
50 0.35
51 0.32
52 0.33
53 0.29
54 0.3
55 0.29
56 0.28
57 0.26
58 0.23
59 0.25
60 0.26
61 0.26
62 0.26
63 0.25
64 0.24
65 0.19
66 0.15
67 0.1
68 0.07
69 0.05
70 0.05
71 0.05
72 0.05
73 0.05
74 0.05
75 0.04
76 0.05
77 0.05
78 0.04
79 0.05
80 0.06
81 0.06
82 0.06
83 0.06
84 0.05
85 0.05
86 0.04
87 0.04
88 0.02
89 0.03
90 0.02
91 0.03
92 0.03
93 0.03
94 0.03
95 0.05
96 0.05
97 0.06
98 0.06
99 0.06
100 0.06
101 0.07
102 0.07
103 0.07
104 0.09
105 0.12
106 0.12
107 0.12
108 0.13
109 0.15
110 0.16
111 0.16
112 0.14
113 0.15
114 0.19
115 0.22
116 0.21
117 0.19
118 0.18
119 0.17
120 0.21
121 0.22
122 0.2
123 0.18
124 0.21
125 0.24
126 0.33
127 0.36
128 0.33
129 0.29
130 0.28
131 0.28
132 0.27
133 0.24
134 0.15
135 0.14
136 0.12
137 0.14
138 0.13
139 0.13
140 0.12
141 0.11
142 0.1
143 0.09
144 0.1
145 0.14
146 0.16
147 0.2
148 0.24
149 0.32
150 0.42
151 0.49
152 0.53
153 0.53
154 0.53