Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6J3LYF9

Protein Details
Accession A0A6J3LYF9    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
144-173RLVKGKKRLTVPNKPRKTPRPRPPEESRAEBasic
NLS Segment(s)
PositionSequence
138-168SAPQRARLVKGKKRLTVPNKPRKTPRPRPPE
Subcellular Location(s) nucl 12, mito 9, cyto 4
Family & Domain DBs
Amino Acid Sequences MVIDIRPNLGPQAISTKTSKPLNKTQSIITNHSFLTIAFTDGINSTPDFPAIASNHPNNFHAPWTSTIFAAVVNPRTSTPRFGCGLTSSTFWRCFLKARSLPFSLPFCRLGRSIFFERKKHKISLHASSIHQGNPRNSAPQRARLVKGKKRLTVPNKPRKTPRPRPPEESRAEGREWYAEGQYARGEERRLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.25
3 0.27
4 0.33
5 0.41
6 0.44
7 0.43
8 0.51
9 0.57
10 0.6
11 0.59
12 0.57
13 0.58
14 0.58
15 0.57
16 0.5
17 0.43
18 0.37
19 0.35
20 0.3
21 0.21
22 0.21
23 0.16
24 0.14
25 0.13
26 0.13
27 0.12
28 0.13
29 0.14
30 0.1
31 0.1
32 0.1
33 0.1
34 0.1
35 0.09
36 0.09
37 0.13
38 0.13
39 0.16
40 0.19
41 0.22
42 0.25
43 0.27
44 0.28
45 0.26
46 0.25
47 0.23
48 0.2
49 0.18
50 0.19
51 0.21
52 0.2
53 0.18
54 0.17
55 0.15
56 0.14
57 0.13
58 0.12
59 0.12
60 0.12
61 0.12
62 0.13
63 0.16
64 0.18
65 0.21
66 0.21
67 0.22
68 0.22
69 0.22
70 0.22
71 0.2
72 0.22
73 0.17
74 0.17
75 0.15
76 0.17
77 0.17
78 0.17
79 0.17
80 0.15
81 0.18
82 0.19
83 0.26
84 0.27
85 0.3
86 0.34
87 0.34
88 0.34
89 0.34
90 0.35
91 0.28
92 0.27
93 0.26
94 0.22
95 0.22
96 0.22
97 0.2
98 0.18
99 0.23
100 0.27
101 0.32
102 0.37
103 0.42
104 0.47
105 0.54
106 0.56
107 0.54
108 0.51
109 0.52
110 0.52
111 0.53
112 0.53
113 0.49
114 0.45
115 0.44
116 0.43
117 0.36
118 0.34
119 0.31
120 0.27
121 0.29
122 0.29
123 0.33
124 0.33
125 0.39
126 0.39
127 0.43
128 0.49
129 0.49
130 0.52
131 0.53
132 0.63
133 0.61
134 0.67
135 0.66
136 0.64
137 0.66
138 0.72
139 0.73
140 0.74
141 0.77
142 0.78
143 0.8
144 0.81
145 0.85
146 0.85
147 0.87
148 0.86
149 0.86
150 0.86
151 0.85
152 0.86
153 0.85
154 0.85
155 0.79
156 0.76
157 0.71
158 0.65
159 0.59
160 0.52
161 0.44
162 0.36
163 0.32
164 0.26
165 0.22
166 0.21
167 0.19
168 0.19
169 0.19
170 0.18
171 0.2
172 0.21