Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6J3MBL9

Protein Details
Accession A0A6J3MBL9    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
62-88VKLGNPPCDRRERKRRRRTAFANPYDLHydrophilic
NLS Segment(s)
PositionSequence
72-79RERKRRRR
Subcellular Location(s) mito 21, nucl 4
Family & Domain DBs
Amino Acid Sequences MPALIEVWAYRIRWRHRSIFHSYRTDKNLPPPSPPPPPPLTMNRPGAYAGGRDLHMYHIATVKLGNPPCDRRERKRRRRTAFANPYDLLFHLPLNGASVQNMGSGGSEVGRRQPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.52
3 0.57
4 0.62
5 0.68
6 0.68
7 0.68
8 0.69
9 0.67
10 0.66
11 0.65
12 0.64
13 0.57
14 0.58
15 0.61
16 0.52
17 0.54
18 0.52
19 0.5
20 0.53
21 0.53
22 0.49
23 0.43
24 0.44
25 0.43
26 0.45
27 0.46
28 0.45
29 0.48
30 0.42
31 0.39
32 0.37
33 0.33
34 0.26
35 0.2
36 0.14
37 0.1
38 0.1
39 0.09
40 0.09
41 0.09
42 0.1
43 0.1
44 0.09
45 0.1
46 0.1
47 0.09
48 0.09
49 0.09
50 0.13
51 0.14
52 0.17
53 0.19
54 0.23
55 0.26
56 0.36
57 0.41
58 0.46
59 0.57
60 0.65
61 0.73
62 0.8
63 0.87
64 0.85
65 0.9
66 0.88
67 0.88
68 0.87
69 0.82
70 0.78
71 0.67
72 0.59
73 0.5
74 0.42
75 0.33
76 0.23
77 0.17
78 0.11
79 0.11
80 0.1
81 0.12
82 0.12
83 0.1
84 0.1
85 0.11
86 0.1
87 0.1
88 0.1
89 0.07
90 0.07
91 0.07
92 0.07
93 0.08
94 0.1
95 0.1