Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6J3LTC1

Protein Details
Accession A0A6J3LTC1    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
48-70KDSLKEHKRGDRRSKRRNGDTVSBasic
NLS Segment(s)
PositionSequence
42-64RKKRAEKDSLKEHKRGDRRSKRR
Subcellular Location(s) nucl 16, mito 7, cyto 3
Family & Domain DBs
Amino Acid Sequences MQRHRIDLLLKTNNEAKPRRAGRSIVLGKARVMSYDDLVEARKKRAEKDSLKEHKRGDRRSKRRNGDTVSTTTVAPTINPSPRDDRAVTESGWGGELEDSAWCAPIAHMY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.49
3 0.43
4 0.46
5 0.51
6 0.53
7 0.5
8 0.49
9 0.45
10 0.51
11 0.52
12 0.47
13 0.45
14 0.4
15 0.36
16 0.37
17 0.33
18 0.23
19 0.21
20 0.16
21 0.13
22 0.13
23 0.13
24 0.11
25 0.12
26 0.16
27 0.16
28 0.17
29 0.2
30 0.21
31 0.24
32 0.31
33 0.39
34 0.41
35 0.47
36 0.55
37 0.61
38 0.64
39 0.65
40 0.61
41 0.59
42 0.6
43 0.62
44 0.63
45 0.64
46 0.7
47 0.76
48 0.83
49 0.84
50 0.83
51 0.82
52 0.76
53 0.71
54 0.65
55 0.58
56 0.51
57 0.43
58 0.36
59 0.28
60 0.24
61 0.17
62 0.13
63 0.13
64 0.15
65 0.19
66 0.21
67 0.24
68 0.28
69 0.31
70 0.36
71 0.33
72 0.31
73 0.32
74 0.33
75 0.3
76 0.27
77 0.25
78 0.2
79 0.2
80 0.16
81 0.11
82 0.09
83 0.09
84 0.07
85 0.07
86 0.08
87 0.07
88 0.08
89 0.07
90 0.08