Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6J3MIN4

Protein Details
Accession A0A6J3MIN4    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-28AGTPNNGKHYCRRRRRRAESSKEAPSTHydrophilic
NLS Segment(s)
PositionSequence
16-16R
Subcellular Location(s) nucl 14.5, mito_nucl 12, mito 8.5, cyto 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAGTPNNGKHYCRRRRRRAESSKEAPSTSSSTMFKTLNVSEVCMWFYSPAGCAALGLVACTVAANHFARSEIRARIRSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.85
3 0.93
4 0.94
5 0.94
6 0.93
7 0.92
8 0.89
9 0.86
10 0.77
11 0.67
12 0.56
13 0.48
14 0.41
15 0.32
16 0.28
17 0.2
18 0.19
19 0.22
20 0.21
21 0.19
22 0.18
23 0.16
24 0.18
25 0.17
26 0.17
27 0.14
28 0.15
29 0.15
30 0.12
31 0.12
32 0.07
33 0.07
34 0.07
35 0.06
36 0.07
37 0.07
38 0.06
39 0.06
40 0.06
41 0.07
42 0.06
43 0.06
44 0.05
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.08
51 0.09
52 0.1
53 0.11
54 0.12
55 0.14
56 0.17
57 0.21
58 0.26
59 0.32