Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6J3MGY9

Protein Details
Accession A0A6J3MGY9    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPKNKGKGGKNRRRGKNENDNEKRELBasic
NLS Segment(s)
PositionSequence
3-16KNKGKGGKNRRRGK
Subcellular Location(s) nucl 16, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR006196  RNA-binding_domain_S1_IF1  
IPR001253  TIF_eIF-1A  
IPR018104  TIF_eIF-1A_CS  
Gene Ontology GO:0003723  F:RNA binding  
GO:0003743  F:translation initiation factor activity  
Pfam View protein in Pfam  
PF01176  eIF-1a  
PROSITE View protein in PROSITE  
PS01262  IF1A  
PS50832  S1_IF1_TYPE  
CDD cd05793  S1_IF1A  
Amino Acid Sequences MPKNKGKGGKNRRRGKNENDNEKRELTFKEEGQEYAQVLKMLGNGRLEALCFDGSKRLAHIRGKLRKKVWINQGDIILLSLRDYQDEKGDVILKYSADEARSLKAYGELPESAKINETDTYGGEEEGGIGFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.88
3 0.87
4 0.87
5 0.88
6 0.87
7 0.82
8 0.75
9 0.7
10 0.6
11 0.52
12 0.43
13 0.38
14 0.33
15 0.29
16 0.3
17 0.29
18 0.28
19 0.28
20 0.27
21 0.22
22 0.19
23 0.19
24 0.14
25 0.13
26 0.12
27 0.13
28 0.13
29 0.14
30 0.13
31 0.12
32 0.13
33 0.13
34 0.12
35 0.1
36 0.1
37 0.08
38 0.08
39 0.08
40 0.1
41 0.11
42 0.11
43 0.12
44 0.14
45 0.18
46 0.21
47 0.28
48 0.34
49 0.43
50 0.5
51 0.54
52 0.53
53 0.56
54 0.58
55 0.58
56 0.58
57 0.56
58 0.53
59 0.48
60 0.47
61 0.39
62 0.35
63 0.27
64 0.18
65 0.1
66 0.08
67 0.07
68 0.06
69 0.07
70 0.08
71 0.09
72 0.11
73 0.12
74 0.12
75 0.12
76 0.16
77 0.14
78 0.15
79 0.15
80 0.13
81 0.12
82 0.14
83 0.13
84 0.11
85 0.13
86 0.13
87 0.14
88 0.16
89 0.16
90 0.14
91 0.16
92 0.17
93 0.17
94 0.19
95 0.18
96 0.18
97 0.2
98 0.21
99 0.19
100 0.2
101 0.18
102 0.17
103 0.17
104 0.17
105 0.15
106 0.15
107 0.19
108 0.17
109 0.16
110 0.14
111 0.12
112 0.11