Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6J3LW11

Protein Details
Accession A0A6J3LW11    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
110-135TTPRSSSEKCEKQKRERKRVRFLDVEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 10, cyto 4.5, plas 4, mito 2, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSHLKTSTFPGTYEILFDALDYEQAISIGELHQGSVRASNIPSPIPERLSFPSTLWPSRILLTTNSATSLLPSKSPSSSSNETLQEKLPNSKPGLLRHPIIARPSSIIITTPRSSSEKCEKQKRERKRVRFLDVETGLEIACCRSELETNEKIPSGFFLPDRVLLREIEEDEVRIWIFLVCLVAMVCFGLVVFVGAAGQGRRAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.15
3 0.14
4 0.13
5 0.12
6 0.09
7 0.09
8 0.08
9 0.07
10 0.07
11 0.07
12 0.07
13 0.05
14 0.06
15 0.06
16 0.08
17 0.08
18 0.08
19 0.1
20 0.1
21 0.11
22 0.13
23 0.13
24 0.13
25 0.13
26 0.16
27 0.17
28 0.17
29 0.18
30 0.19
31 0.21
32 0.23
33 0.23
34 0.24
35 0.26
36 0.28
37 0.27
38 0.24
39 0.3
40 0.3
41 0.31
42 0.29
43 0.26
44 0.24
45 0.25
46 0.25
47 0.19
48 0.16
49 0.19
50 0.19
51 0.17
52 0.17
53 0.16
54 0.14
55 0.14
56 0.16
57 0.12
58 0.12
59 0.14
60 0.15
61 0.15
62 0.18
63 0.19
64 0.22
65 0.25
66 0.27
67 0.3
68 0.32
69 0.33
70 0.32
71 0.32
72 0.29
73 0.26
74 0.28
75 0.26
76 0.26
77 0.26
78 0.29
79 0.31
80 0.31
81 0.36
82 0.33
83 0.31
84 0.3
85 0.31
86 0.28
87 0.27
88 0.24
89 0.18
90 0.16
91 0.16
92 0.14
93 0.11
94 0.1
95 0.1
96 0.14
97 0.14
98 0.13
99 0.15
100 0.17
101 0.18
102 0.23
103 0.31
104 0.36
105 0.43
106 0.53
107 0.59
108 0.67
109 0.76
110 0.81
111 0.83
112 0.84
113 0.86
114 0.87
115 0.87
116 0.83
117 0.79
118 0.71
119 0.69
120 0.6
121 0.51
122 0.4
123 0.32
124 0.25
125 0.19
126 0.16
127 0.07
128 0.06
129 0.05
130 0.05
131 0.06
132 0.09
133 0.12
134 0.19
135 0.23
136 0.25
137 0.26
138 0.26
139 0.25
140 0.22
141 0.21
142 0.17
143 0.14
144 0.13
145 0.14
146 0.15
147 0.19
148 0.22
149 0.22
150 0.21
151 0.19
152 0.21
153 0.21
154 0.21
155 0.2
156 0.18
157 0.17
158 0.16
159 0.17
160 0.15
161 0.12
162 0.11
163 0.08
164 0.07
165 0.07
166 0.07
167 0.06
168 0.06
169 0.06
170 0.06
171 0.06
172 0.06
173 0.05
174 0.04
175 0.04
176 0.03
177 0.03
178 0.03
179 0.03
180 0.03
181 0.03
182 0.04
183 0.06
184 0.06