Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6J3MKG6

Protein Details
Accession A0A6J3MKG6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
440-459SSAHRMRLPRRTARSKRLAGHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR002293  AA/rel_permease1  
Gene Ontology GO:0016020  C:membrane  
GO:0022857  F:transmembrane transporter activity  
Pfam View protein in Pfam  
PF13520  AA_permease_2  
Amino Acid Sequences MAHQAPQLAPPRDSLELASLASSSHDHGRASQDSSSSGAPSSRKLSSDDATPTRQINHNRRSYSVSSTFDFNNALFPLTSSGAGYTALGTPNTSTFDTPGQQNLERNKSLTFLNGLSLVVGVIIGSGIFSSPASVNSNAGSPGAALIIWVISGILAWTGAASYAELGGALPLNGGAQVYLAKIFGEWAGFVFTWCSVAVLKPGSAAIVSLILGEYLVRAVVGADAEAVNPWVNKGVAFAALIIVTLMNCVSTKLGTRSADIFMFFKIAGLLVITITGIVVGTTGLAYNKASLSTTWRTTPWFEGTSTSSSQWAVALYAGLWAYDGWDNTNFVVGEMVDPGRDLPKVIHTALPLVIVSYILANLAYIFVLPTEIIQHSNTIAVDFASVVYGPAGAIVLAIAVAGSCFGALNASTFTTGRLIYKASKENYIPEFFSTIGFSSSAHRMRLPRRTARSKRLAGWLADEPGFFFTPIYALILNAVLTSAYLAVGDFQTLTTFYGVASYLFYFAAVVGLIVLRVKEPDLERPYKCWIITPIIFCCVSLFLVSRAVFAKPLQALIVFGFLAIGIPLYWFRLGRNHSRSGGHETIPWWKIWKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.25
3 0.23
4 0.22
5 0.2
6 0.15
7 0.13
8 0.13
9 0.13
10 0.12
11 0.16
12 0.18
13 0.18
14 0.21
15 0.27
16 0.29
17 0.32
18 0.32
19 0.28
20 0.27
21 0.29
22 0.27
23 0.21
24 0.19
25 0.2
26 0.19
27 0.22
28 0.25
29 0.26
30 0.26
31 0.29
32 0.33
33 0.31
34 0.36
35 0.4
36 0.4
37 0.41
38 0.43
39 0.41
40 0.4
41 0.45
42 0.49
43 0.51
44 0.56
45 0.61
46 0.61
47 0.62
48 0.65
49 0.61
50 0.59
51 0.56
52 0.5
53 0.42
54 0.43
55 0.4
56 0.35
57 0.33
58 0.24
59 0.21
60 0.17
61 0.17
62 0.14
63 0.14
64 0.15
65 0.15
66 0.15
67 0.12
68 0.11
69 0.11
70 0.11
71 0.1
72 0.09
73 0.09
74 0.1
75 0.1
76 0.1
77 0.11
78 0.12
79 0.15
80 0.15
81 0.14
82 0.14
83 0.18
84 0.2
85 0.21
86 0.24
87 0.26
88 0.28
89 0.33
90 0.39
91 0.43
92 0.41
93 0.41
94 0.37
95 0.34
96 0.32
97 0.28
98 0.23
99 0.16
100 0.16
101 0.16
102 0.15
103 0.13
104 0.12
105 0.09
106 0.06
107 0.05
108 0.04
109 0.03
110 0.03
111 0.02
112 0.02
113 0.02
114 0.02
115 0.03
116 0.03
117 0.05
118 0.05
119 0.08
120 0.11
121 0.12
122 0.13
123 0.13
124 0.15
125 0.13
126 0.13
127 0.11
128 0.07
129 0.07
130 0.06
131 0.05
132 0.04
133 0.04
134 0.04
135 0.03
136 0.03
137 0.03
138 0.02
139 0.02
140 0.02
141 0.02
142 0.02
143 0.02
144 0.02
145 0.03
146 0.03
147 0.03
148 0.03
149 0.03
150 0.04
151 0.04
152 0.04
153 0.04
154 0.04
155 0.04
156 0.04
157 0.03
158 0.03
159 0.03
160 0.03
161 0.03
162 0.03
163 0.03
164 0.04
165 0.04
166 0.05
167 0.05
168 0.05
169 0.05
170 0.05
171 0.06
172 0.05
173 0.05
174 0.05
175 0.07
176 0.07
177 0.07
178 0.07
179 0.07
180 0.08
181 0.08
182 0.08
183 0.06
184 0.07
185 0.09
186 0.1
187 0.09
188 0.09
189 0.09
190 0.08
191 0.08
192 0.07
193 0.05
194 0.04
195 0.04
196 0.04
197 0.04
198 0.04
199 0.04
200 0.04
201 0.03
202 0.03
203 0.03
204 0.02
205 0.02
206 0.03
207 0.03
208 0.03
209 0.03
210 0.04
211 0.04
212 0.04
213 0.04
214 0.05
215 0.05
216 0.05
217 0.05
218 0.06
219 0.06
220 0.06
221 0.07
222 0.07
223 0.07
224 0.07
225 0.07
226 0.06
227 0.05
228 0.05
229 0.04
230 0.04
231 0.03
232 0.03
233 0.03
234 0.03
235 0.03
236 0.04
237 0.04
238 0.04
239 0.06
240 0.09
241 0.14
242 0.14
243 0.16
244 0.17
245 0.18
246 0.18
247 0.17
248 0.16
249 0.11
250 0.11
251 0.1
252 0.08
253 0.06
254 0.06
255 0.05
256 0.04
257 0.04
258 0.03
259 0.03
260 0.03
261 0.03
262 0.02
263 0.02
264 0.02
265 0.02
266 0.02
267 0.02
268 0.02
269 0.02
270 0.03
271 0.03
272 0.03
273 0.04
274 0.04
275 0.05
276 0.05
277 0.05
278 0.05
279 0.11
280 0.14
281 0.15
282 0.16
283 0.17
284 0.18
285 0.19
286 0.22
287 0.19
288 0.18
289 0.16
290 0.17
291 0.19
292 0.2
293 0.2
294 0.18
295 0.15
296 0.14
297 0.13
298 0.11
299 0.09
300 0.07
301 0.05
302 0.05
303 0.04
304 0.05
305 0.05
306 0.04
307 0.04
308 0.04
309 0.05
310 0.06
311 0.06
312 0.06
313 0.07
314 0.08
315 0.08
316 0.1
317 0.08
318 0.07
319 0.08
320 0.06
321 0.06
322 0.06
323 0.07
324 0.05
325 0.05
326 0.05
327 0.06
328 0.06
329 0.06
330 0.06
331 0.1
332 0.13
333 0.14
334 0.15
335 0.14
336 0.15
337 0.15
338 0.15
339 0.11
340 0.08
341 0.07
342 0.06
343 0.05
344 0.04
345 0.04
346 0.03
347 0.03
348 0.03
349 0.03
350 0.03
351 0.03
352 0.03
353 0.03
354 0.03
355 0.03
356 0.03
357 0.03
358 0.05
359 0.06
360 0.08
361 0.08
362 0.09
363 0.09
364 0.1
365 0.1
366 0.08
367 0.07
368 0.06
369 0.06
370 0.05
371 0.05
372 0.04
373 0.04
374 0.04
375 0.04
376 0.04
377 0.03
378 0.03
379 0.03
380 0.03
381 0.03
382 0.02
383 0.02
384 0.02
385 0.02
386 0.02
387 0.02
388 0.02
389 0.02
390 0.02
391 0.02
392 0.02
393 0.02
394 0.03
395 0.03
396 0.04
397 0.05
398 0.06
399 0.07
400 0.07
401 0.08
402 0.09
403 0.09
404 0.1
405 0.1
406 0.12
407 0.15
408 0.2
409 0.26
410 0.26
411 0.3
412 0.3
413 0.35
414 0.37
415 0.36
416 0.32
417 0.26
418 0.26
419 0.22
420 0.22
421 0.17
422 0.13
423 0.11
424 0.1
425 0.1
426 0.11
427 0.18
428 0.2
429 0.2
430 0.23
431 0.29
432 0.36
433 0.45
434 0.5
435 0.53
436 0.6
437 0.7
438 0.76
439 0.79
440 0.82
441 0.78
442 0.74
443 0.74
444 0.69
445 0.59
446 0.55
447 0.47
448 0.41
449 0.36
450 0.31
451 0.22
452 0.2
453 0.2
454 0.15
455 0.12
456 0.09
457 0.09
458 0.09
459 0.1
460 0.07
461 0.06
462 0.07
463 0.07
464 0.07
465 0.07
466 0.06
467 0.04
468 0.04
469 0.05
470 0.04
471 0.04
472 0.04
473 0.04
474 0.05
475 0.05
476 0.05
477 0.05
478 0.05
479 0.06
480 0.07
481 0.08
482 0.07
483 0.07
484 0.07
485 0.08
486 0.08
487 0.08
488 0.09
489 0.08
490 0.09
491 0.09
492 0.09
493 0.08
494 0.07
495 0.07
496 0.05
497 0.05
498 0.04
499 0.04
500 0.04
501 0.05
502 0.05
503 0.05
504 0.06
505 0.07
506 0.11
507 0.14
508 0.23
509 0.31
510 0.38
511 0.39
512 0.42
513 0.49
514 0.49
515 0.47
516 0.42
517 0.38
518 0.39
519 0.42
520 0.43
521 0.39
522 0.38
523 0.38
524 0.33
525 0.3
526 0.23
527 0.18
528 0.15
529 0.14
530 0.12
531 0.18
532 0.18
533 0.19
534 0.19
535 0.19
536 0.2
537 0.18
538 0.23
539 0.18
540 0.19
541 0.18
542 0.17
543 0.17
544 0.16
545 0.17
546 0.11
547 0.1
548 0.09
549 0.07
550 0.07
551 0.06
552 0.06
553 0.04
554 0.05
555 0.06
556 0.08
557 0.1
558 0.11
559 0.12
560 0.2
561 0.26
562 0.36
563 0.42
564 0.47
565 0.49
566 0.53
567 0.55
568 0.57
569 0.56
570 0.47
571 0.43
572 0.39
573 0.44
574 0.42
575 0.39