Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6J3LTT1

Protein Details
Accession A0A6J3LTT1    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
2-32KKGGEEVEEKRRKKRRRRREKIEGRRRGGGRBasic
NLS Segment(s)
PositionSequence
10-47EKRRKKRRRRREKIEGRRRGGGRRPPERAKAGRWTPTP
Subcellular Location(s) nucl 13, mito 11, cyto 2
Family & Domain DBs
Amino Acid Sequences MKKGGEEVEEKRRKKRRRRREKIEGRRRGGGRRPPERAKAGRWTPTPTKGGERRMENDAHPALPIPSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.81
3 0.81
4 0.84
5 0.92
6 0.93
7 0.94
8 0.96
9 0.96
10 0.96
11 0.94
12 0.87
13 0.84
14 0.76
15 0.71
16 0.68
17 0.65
18 0.63
19 0.6
20 0.63
21 0.59
22 0.62
23 0.62
24 0.57
25 0.53
26 0.53
27 0.51
28 0.51
29 0.48
30 0.5
31 0.48
32 0.5
33 0.48
34 0.41
35 0.45
36 0.44
37 0.5
38 0.5
39 0.5
40 0.48
41 0.5
42 0.51
43 0.43
44 0.44
45 0.38
46 0.32
47 0.27
48 0.24