Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6J3M1J0

Protein Details
Accession A0A6J3M1J0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
71-92ISHPHHMRRRGHRLKAEGRCRCBasic
NLS Segment(s)
Subcellular Location(s) plas 18, mito 4, E.R. 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MIIIMIIVHIRTIDSAIEHGYPYIELNCFYSIPFNDPPECVSFLSFRAMSGMDGIFPGDMLVLVVLWLSIISHPHHMRRRGHRLKAEGRCRCWFPHYCRMMKPAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.09
4 0.1
5 0.1
6 0.1
7 0.09
8 0.09
9 0.09
10 0.1
11 0.09
12 0.09
13 0.11
14 0.12
15 0.12
16 0.12
17 0.14
18 0.13
19 0.17
20 0.19
21 0.2
22 0.2
23 0.2
24 0.22
25 0.21
26 0.22
27 0.17
28 0.16
29 0.14
30 0.14
31 0.16
32 0.14
33 0.11
34 0.1
35 0.1
36 0.09
37 0.09
38 0.08
39 0.05
40 0.05
41 0.05
42 0.04
43 0.04
44 0.04
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.03
57 0.05
58 0.06
59 0.13
60 0.16
61 0.24
62 0.31
63 0.39
64 0.47
65 0.55
66 0.66
67 0.69
68 0.75
69 0.75
70 0.77
71 0.8
72 0.82
73 0.83
74 0.8
75 0.76
76 0.73
77 0.69
78 0.64
79 0.61
80 0.6
81 0.58
82 0.6
83 0.62
84 0.62
85 0.63