Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6YCE3

Protein Details
Accession A0A6A6YCE3    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-49VASKKHVPIVKKHTKRFNRHQSDRFMCVDPSWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
35-50KPKGIDNRVRRRFKGQ
Subcellular Location(s) mito 18.5, mito_nucl 12.333, nucl 5, cyto_nucl 4.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVASKKHVPIVKKHTKRFNRHQSDRFMCVDPSWRKPKGIDNRVRRRFKGQAAMPKIGYGSNKKTRHLMPSGHKAFLVHNIRDVDLLLMQNRTFAAEISHSVSARKRIEIVARAKQLSVKVTNGKARVKTES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.81
3 0.87
4 0.88
5 0.89
6 0.88
7 0.89
8 0.87
9 0.87
10 0.82
11 0.77
12 0.7
13 0.6
14 0.5
15 0.41
16 0.44
17 0.38
18 0.41
19 0.44
20 0.42
21 0.41
22 0.43
23 0.52
24 0.53
25 0.58
26 0.6
27 0.63
28 0.72
29 0.8
30 0.84
31 0.77
32 0.73
33 0.69
34 0.65
35 0.63
36 0.58
37 0.58
38 0.57
39 0.57
40 0.5
41 0.43
42 0.38
43 0.3
44 0.27
45 0.22
46 0.24
47 0.31
48 0.33
49 0.34
50 0.37
51 0.38
52 0.41
53 0.4
54 0.39
55 0.36
56 0.44
57 0.45
58 0.42
59 0.4
60 0.35
61 0.31
62 0.34
63 0.33
64 0.23
65 0.24
66 0.25
67 0.25
68 0.25
69 0.24
70 0.15
71 0.11
72 0.12
73 0.09
74 0.1
75 0.09
76 0.1
77 0.09
78 0.1
79 0.09
80 0.08
81 0.08
82 0.08
83 0.1
84 0.13
85 0.15
86 0.14
87 0.16
88 0.19
89 0.25
90 0.26
91 0.25
92 0.24
93 0.25
94 0.32
95 0.37
96 0.42
97 0.44
98 0.47
99 0.47
100 0.46
101 0.45
102 0.42
103 0.4
104 0.36
105 0.33
106 0.34
107 0.4
108 0.46
109 0.5
110 0.53
111 0.53