Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6YQ75

Protein Details
Accession A0A6A6YQ75    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MLRKDIKKEPYKLKNPNGKIPTHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 10.5, cyto_pero 8.5, mito 8, pero 5.5, mito_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010987  Glutathione-S-Trfase_C-like  
IPR036282  Glutathione-S-Trfase_C_sf  
IPR004046  GST_C  
Gene Ontology GO:0016740  F:transferase activity  
Pfam View protein in Pfam  
PF00043  GST_C  
PROSITE View protein in PROSITE  
PS50405  GST_CTER  
Amino Acid Sequences MLRKDIKKEPYKLKNPNGKIPTIEDPNTGITLFEPIRCYHPIPRRHIYEITNKLAYTTFPEKYLTLSWLSLQMSTHGTYFVWFHPEKNSTAAIDRYGNEMKRIVGVIDRHLKRTGTQYLIGDKCTYADLAFVMWDQIMPLLVGDWDFKTEAPDFAAWNERVVAQSAVQRDLAGGGKAPSTDRTAPVLKLGAGLVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.83
3 0.85
4 0.79
5 0.71
6 0.63
7 0.58
8 0.55
9 0.52
10 0.47
11 0.38
12 0.35
13 0.34
14 0.32
15 0.26
16 0.19
17 0.12
18 0.16
19 0.15
20 0.15
21 0.15
22 0.16
23 0.2
24 0.22
25 0.25
26 0.29
27 0.37
28 0.43
29 0.49
30 0.56
31 0.57
32 0.6
33 0.61
34 0.57
35 0.59
36 0.57
37 0.54
38 0.48
39 0.43
40 0.38
41 0.34
42 0.3
43 0.26
44 0.24
45 0.2
46 0.19
47 0.21
48 0.2
49 0.22
50 0.23
51 0.18
52 0.15
53 0.14
54 0.13
55 0.15
56 0.15
57 0.14
58 0.12
59 0.12
60 0.12
61 0.13
62 0.12
63 0.09
64 0.09
65 0.09
66 0.1
67 0.09
68 0.13
69 0.12
70 0.13
71 0.17
72 0.19
73 0.2
74 0.2
75 0.21
76 0.16
77 0.18
78 0.17
79 0.15
80 0.14
81 0.14
82 0.16
83 0.18
84 0.17
85 0.16
86 0.16
87 0.14
88 0.14
89 0.13
90 0.09
91 0.1
92 0.1
93 0.14
94 0.22
95 0.23
96 0.25
97 0.26
98 0.26
99 0.25
100 0.3
101 0.29
102 0.23
103 0.25
104 0.24
105 0.3
106 0.3
107 0.3
108 0.25
109 0.2
110 0.18
111 0.16
112 0.14
113 0.07
114 0.07
115 0.06
116 0.05
117 0.06
118 0.05
119 0.05
120 0.04
121 0.04
122 0.04
123 0.04
124 0.04
125 0.04
126 0.03
127 0.03
128 0.04
129 0.04
130 0.05
131 0.06
132 0.07
133 0.07
134 0.08
135 0.1
136 0.11
137 0.12
138 0.13
139 0.13
140 0.13
141 0.14
142 0.21
143 0.18
144 0.18
145 0.18
146 0.16
147 0.16
148 0.18
149 0.17
150 0.12
151 0.16
152 0.17
153 0.18
154 0.18
155 0.17
156 0.15
157 0.16
158 0.16
159 0.13
160 0.12
161 0.11
162 0.12
163 0.13
164 0.14
165 0.15
166 0.19
167 0.21
168 0.22
169 0.27
170 0.29
171 0.29
172 0.31
173 0.31
174 0.25
175 0.23