Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q8SVV5

Protein Details
Accession Q8SVV5   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MNRKIYKRNKKVVKLLSKIGFHydrophilic
59-79ITKCVYKKFKEAKRNHRKGISHydrophilic
NLS Segment(s)
PositionSequence
71-74KRNH
Subcellular Location(s) mito 16, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR006984  Fcf1/Utp23  
Gene Ontology GO:0032040  C:small-subunit processome  
KEGG ecu:ECU04_0590  -  
Pfam View protein in Pfam  
PF04900  Fcf1  
Amino Acid Sequences MNRKIYKRNKKVVKLLSKIGFRSPYQIVVEETFIDAMNRDMLGLRDINDLFKSQPKLFITKCVYKKFKEAKRNHRKGISKYLEILNCNHKDVRNPLSCLRRVLRKSNKNHYILASNCQEITDLINVEKKIPAITCRGGTLIINADLQKVPLYSGFKTEADEKELSRLEALFPEDT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.78
4 0.73
5 0.66
6 0.62
7 0.56
8 0.46
9 0.46
10 0.39
11 0.36
12 0.33
13 0.32
14 0.29
15 0.25
16 0.26
17 0.21
18 0.19
19 0.15
20 0.13
21 0.11
22 0.09
23 0.08
24 0.08
25 0.07
26 0.06
27 0.07
28 0.07
29 0.09
30 0.09
31 0.1
32 0.13
33 0.13
34 0.15
35 0.15
36 0.15
37 0.14
38 0.19
39 0.22
40 0.19
41 0.25
42 0.26
43 0.31
44 0.3
45 0.37
46 0.38
47 0.43
48 0.49
49 0.52
50 0.54
51 0.5
52 0.6
53 0.61
54 0.63
55 0.65
56 0.69
57 0.71
58 0.78
59 0.85
60 0.81
61 0.79
62 0.78
63 0.73
64 0.74
65 0.67
66 0.57
67 0.51
68 0.5
69 0.43
70 0.38
71 0.34
72 0.31
73 0.27
74 0.27
75 0.25
76 0.21
77 0.22
78 0.26
79 0.31
80 0.28
81 0.3
82 0.34
83 0.39
84 0.4
85 0.41
86 0.4
87 0.4
88 0.4
89 0.47
90 0.52
91 0.55
92 0.61
93 0.68
94 0.74
95 0.68
96 0.67
97 0.58
98 0.54
99 0.47
100 0.44
101 0.36
102 0.28
103 0.25
104 0.23
105 0.21
106 0.14
107 0.15
108 0.11
109 0.09
110 0.1
111 0.14
112 0.14
113 0.15
114 0.15
115 0.14
116 0.14
117 0.14
118 0.16
119 0.17
120 0.2
121 0.2
122 0.2
123 0.21
124 0.2
125 0.18
126 0.18
127 0.16
128 0.14
129 0.15
130 0.14
131 0.15
132 0.15
133 0.15
134 0.14
135 0.11
136 0.11
137 0.13
138 0.17
139 0.15
140 0.19
141 0.22
142 0.22
143 0.24
144 0.29
145 0.27
146 0.29
147 0.3
148 0.27
149 0.3
150 0.31
151 0.29
152 0.25
153 0.23
154 0.19
155 0.2