Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6YI03

Protein Details
Accession A0A6A6YI03    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
35-55LPPFPPKTRKSKHPNPPPSTLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
Amino Acid Sequences MWKLVAVLQAGAVRRPSTLFKPHLYVPKTSGPTLLPPFPPKTRKSKHPNPPPSTLPIPVAFSPAPKSTPADPPLENEARASASLDAHPSTAPAASNCVRTPRLFSQLHTGCATYCNKPHAHVRNPDQPQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.2
4 0.23
5 0.31
6 0.34
7 0.35
8 0.39
9 0.43
10 0.5
11 0.48
12 0.44
13 0.4
14 0.44
15 0.44
16 0.4
17 0.37
18 0.29
19 0.33
20 0.35
21 0.34
22 0.28
23 0.29
24 0.34
25 0.39
26 0.43
27 0.41
28 0.48
29 0.51
30 0.58
31 0.64
32 0.69
33 0.73
34 0.78
35 0.85
36 0.8
37 0.79
38 0.72
39 0.68
40 0.6
41 0.5
42 0.41
43 0.31
44 0.28
45 0.22
46 0.22
47 0.17
48 0.15
49 0.16
50 0.15
51 0.15
52 0.13
53 0.15
54 0.15
55 0.21
56 0.23
57 0.23
58 0.23
59 0.24
60 0.3
61 0.29
62 0.26
63 0.21
64 0.19
65 0.16
66 0.16
67 0.14
68 0.08
69 0.08
70 0.09
71 0.1
72 0.1
73 0.1
74 0.09
75 0.09
76 0.08
77 0.08
78 0.08
79 0.07
80 0.12
81 0.13
82 0.16
83 0.17
84 0.21
85 0.23
86 0.23
87 0.3
88 0.29
89 0.36
90 0.34
91 0.35
92 0.41
93 0.42
94 0.45
95 0.39
96 0.35
97 0.27
98 0.3
99 0.32
100 0.27
101 0.28
102 0.3
103 0.3
104 0.33
105 0.43
106 0.48
107 0.53
108 0.58
109 0.62