Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6YHF5

Protein Details
Accession A0A6A6YHF5    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
62-96MTDARRQREKERGRSGSRRKKRHWNKLLWFKQPYPBasic
NLS Segment(s)
PositionSequence
66-85RRQREKERGRSGSRRKKRHW
Subcellular Location(s) plas 21, mito 2, nucl 1, cyto 1, cyto_nucl 1, E.R. 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR009450  Plno_GlcNAc_GPI2  
Gene Ontology GO:0016020  C:membrane  
GO:0006506  P:GPI anchor biosynthetic process  
Pfam View protein in Pfam  
PF06432  GPI2  
Amino Acid Sequences MSTTTVQQHAASRQLLHSRTAAPDPSRLAPEDAFYATSPPRRARQHSPLGLGASGGSSVRGMTDARRQREKERGRSGSRRKKRHWNKLLWFKQPYPDNYTDEETFLDHLQRNPRLQPYEFWSLMADSTVIIQHIASVIIFICCFVGIKEINVSPVAVASAGSISTVLGWILWDYWMGKEEAAKAQALAEKEFAEDASSASSTSSLKDPQGLGLLIPNGSNTPRLGHSHSASATSVTSNMSASSATVPSGSATQYPPYGDPESSLSPRNRQRLATAKSAVLIYCALLGLSPILKSLTDSTTSDSIWAMSSWLMCMNVFFFDYGGGTGAQFPASLSTNAAVMASAVMASRLPSTTHVFSLTLFSIEVFGLFPVFRRQLRNSSSAGHRTLTYFLVIAASGGMGVIISNGGAVAAIVGAVLGSVLTFLVMGICCWWLIGLQKYKNEMYGPWDPARPIIRRHWDLSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.4
3 0.37
4 0.37
5 0.34
6 0.36
7 0.38
8 0.39
9 0.34
10 0.37
11 0.38
12 0.39
13 0.39
14 0.37
15 0.36
16 0.3
17 0.29
18 0.28
19 0.24
20 0.22
21 0.19
22 0.21
23 0.22
24 0.27
25 0.31
26 0.33
27 0.4
28 0.47
29 0.54
30 0.6
31 0.66
32 0.7
33 0.71
34 0.7
35 0.66
36 0.59
37 0.52
38 0.42
39 0.32
40 0.21
41 0.16
42 0.11
43 0.08
44 0.06
45 0.06
46 0.06
47 0.07
48 0.07
49 0.1
50 0.2
51 0.29
52 0.35
53 0.45
54 0.48
55 0.54
56 0.64
57 0.7
58 0.71
59 0.74
60 0.76
61 0.76
62 0.83
63 0.88
64 0.88
65 0.88
66 0.88
67 0.86
68 0.88
69 0.9
70 0.91
71 0.9
72 0.9
73 0.9
74 0.91
75 0.92
76 0.89
77 0.85
78 0.76
79 0.73
80 0.69
81 0.63
82 0.6
83 0.56
84 0.5
85 0.47
86 0.49
87 0.42
88 0.36
89 0.32
90 0.24
91 0.21
92 0.18
93 0.19
94 0.16
95 0.2
96 0.27
97 0.31
98 0.33
99 0.36
100 0.42
101 0.43
102 0.42
103 0.42
104 0.4
105 0.43
106 0.4
107 0.36
108 0.3
109 0.26
110 0.24
111 0.21
112 0.14
113 0.06
114 0.07
115 0.07
116 0.06
117 0.05
118 0.05
119 0.05
120 0.05
121 0.05
122 0.04
123 0.04
124 0.05
125 0.05
126 0.05
127 0.05
128 0.04
129 0.04
130 0.05
131 0.04
132 0.08
133 0.08
134 0.09
135 0.11
136 0.11
137 0.13
138 0.13
139 0.13
140 0.09
141 0.08
142 0.08
143 0.05
144 0.05
145 0.04
146 0.04
147 0.04
148 0.04
149 0.04
150 0.03
151 0.03
152 0.03
153 0.03
154 0.03
155 0.03
156 0.03
157 0.03
158 0.04
159 0.04
160 0.05
161 0.05
162 0.06
163 0.07
164 0.07
165 0.08
166 0.1
167 0.12
168 0.13
169 0.12
170 0.11
171 0.12
172 0.14
173 0.14
174 0.13
175 0.11
176 0.1
177 0.11
178 0.11
179 0.09
180 0.08
181 0.07
182 0.06
183 0.06
184 0.06
185 0.06
186 0.06
187 0.07
188 0.06
189 0.07
190 0.09
191 0.09
192 0.09
193 0.12
194 0.12
195 0.11
196 0.13
197 0.12
198 0.1
199 0.09
200 0.1
201 0.08
202 0.07
203 0.07
204 0.06
205 0.06
206 0.07
207 0.06
208 0.07
209 0.09
210 0.12
211 0.15
212 0.17
213 0.18
214 0.2
215 0.2
216 0.2
217 0.18
218 0.16
219 0.13
220 0.1
221 0.1
222 0.07
223 0.07
224 0.06
225 0.06
226 0.06
227 0.05
228 0.05
229 0.06
230 0.06
231 0.06
232 0.06
233 0.06
234 0.06
235 0.07
236 0.07
237 0.07
238 0.07
239 0.08
240 0.09
241 0.1
242 0.1
243 0.14
244 0.15
245 0.13
246 0.13
247 0.16
248 0.18
249 0.19
250 0.24
251 0.21
252 0.27
253 0.34
254 0.39
255 0.38
256 0.36
257 0.4
258 0.44
259 0.47
260 0.47
261 0.42
262 0.36
263 0.35
264 0.34
265 0.29
266 0.2
267 0.15
268 0.08
269 0.06
270 0.06
271 0.05
272 0.04
273 0.04
274 0.04
275 0.04
276 0.04
277 0.04
278 0.05
279 0.05
280 0.06
281 0.08
282 0.09
283 0.11
284 0.12
285 0.15
286 0.16
287 0.16
288 0.15
289 0.13
290 0.12
291 0.1
292 0.1
293 0.07
294 0.06
295 0.06
296 0.06
297 0.07
298 0.07
299 0.06
300 0.07
301 0.07
302 0.07
303 0.07
304 0.07
305 0.06
306 0.06
307 0.06
308 0.06
309 0.06
310 0.06
311 0.05
312 0.06
313 0.06
314 0.06
315 0.06
316 0.06
317 0.07
318 0.09
319 0.09
320 0.09
321 0.09
322 0.09
323 0.09
324 0.09
325 0.07
326 0.05
327 0.05
328 0.04
329 0.04
330 0.03
331 0.04
332 0.04
333 0.05
334 0.05
335 0.06
336 0.07
337 0.1
338 0.15
339 0.17
340 0.18
341 0.19
342 0.18
343 0.18
344 0.21
345 0.18
346 0.14
347 0.12
348 0.11
349 0.1
350 0.1
351 0.1
352 0.06
353 0.06
354 0.06
355 0.06
356 0.07
357 0.12
358 0.16
359 0.19
360 0.25
361 0.3
362 0.38
363 0.43
364 0.46
365 0.42
366 0.44
367 0.49
368 0.48
369 0.46
370 0.39
371 0.35
372 0.32
373 0.32
374 0.27
375 0.21
376 0.15
377 0.13
378 0.12
379 0.11
380 0.09
381 0.07
382 0.05
383 0.04
384 0.04
385 0.04
386 0.03
387 0.03
388 0.03
389 0.03
390 0.02
391 0.02
392 0.03
393 0.03
394 0.03
395 0.02
396 0.02
397 0.02
398 0.02
399 0.02
400 0.02
401 0.02
402 0.02
403 0.02
404 0.02
405 0.02
406 0.02
407 0.02
408 0.02
409 0.02
410 0.03
411 0.05
412 0.05
413 0.05
414 0.06
415 0.07
416 0.07
417 0.07
418 0.07
419 0.07
420 0.12
421 0.2
422 0.28
423 0.34
424 0.39
425 0.44
426 0.45
427 0.47
428 0.43
429 0.37
430 0.35
431 0.38
432 0.39
433 0.38
434 0.4
435 0.37
436 0.42
437 0.47
438 0.45
439 0.43
440 0.47
441 0.53
442 0.56