Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6A6Y421

Protein Details
Accession A0A6A6Y421    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
38-62ITWKFFLKGWKSRPRPKLERRALVPHydrophilic
NLS Segment(s)
PositionSequence
48-55KSRPRPKL
Subcellular Location(s) nucl 15, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR024621  Mba1  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0032979  P:protein insertion into mitochondrial inner membrane from matrix  
Pfam View protein in Pfam  
PF07961  MBA1  
Amino Acid Sequences MIKPTGKNLPSIFRKPRERLDIEWQSLKRRTMDKFGLITWKFFLKGWKSRPRPKLERRALVPLAKDYHSQIYTAFAAHDTPTITRLCCSGLAADFRARMSHRALGTHVTWSLASYTASPKIVSNRASPLPGLQRSGVRQVVVRLASKQILATWTDEQARAAVPADVETVESEVTEYLVLQRRMLEGVEEAWMVWGFAEESTPEVRRRDEKMTRELEEYQRAQSSLQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.71
3 0.77
4 0.77
5 0.73
6 0.69
7 0.71
8 0.71
9 0.66
10 0.68
11 0.61
12 0.6
13 0.6
14 0.57
15 0.52
16 0.49
17 0.48
18 0.48
19 0.52
20 0.5
21 0.47
22 0.46
23 0.5
24 0.45
25 0.42
26 0.35
27 0.31
28 0.26
29 0.25
30 0.3
31 0.28
32 0.36
33 0.45
34 0.54
35 0.61
36 0.7
37 0.78
38 0.81
39 0.84
40 0.85
41 0.87
42 0.86
43 0.85
44 0.79
45 0.79
46 0.73
47 0.66
48 0.57
49 0.5
50 0.44
51 0.37
52 0.34
53 0.27
54 0.28
55 0.24
56 0.23
57 0.18
58 0.18
59 0.17
60 0.16
61 0.14
62 0.09
63 0.09
64 0.09
65 0.1
66 0.08
67 0.08
68 0.1
69 0.1
70 0.1
71 0.1
72 0.1
73 0.1
74 0.1
75 0.1
76 0.09
77 0.1
78 0.11
79 0.12
80 0.13
81 0.13
82 0.12
83 0.14
84 0.13
85 0.14
86 0.15
87 0.18
88 0.17
89 0.17
90 0.18
91 0.19
92 0.19
93 0.18
94 0.15
95 0.11
96 0.11
97 0.1
98 0.09
99 0.07
100 0.07
101 0.06
102 0.08
103 0.09
104 0.1
105 0.1
106 0.1
107 0.13
108 0.17
109 0.18
110 0.19
111 0.21
112 0.22
113 0.22
114 0.21
115 0.21
116 0.23
117 0.22
118 0.22
119 0.19
120 0.2
121 0.21
122 0.26
123 0.24
124 0.18
125 0.18
126 0.17
127 0.2
128 0.2
129 0.19
130 0.15
131 0.16
132 0.17
133 0.16
134 0.15
135 0.12
136 0.11
137 0.11
138 0.13
139 0.12
140 0.14
141 0.15
142 0.15
143 0.15
144 0.14
145 0.13
146 0.11
147 0.1
148 0.08
149 0.07
150 0.07
151 0.08
152 0.07
153 0.07
154 0.07
155 0.07
156 0.06
157 0.06
158 0.06
159 0.05
160 0.05
161 0.05
162 0.05
163 0.09
164 0.16
165 0.17
166 0.17
167 0.18
168 0.19
169 0.2
170 0.2
171 0.16
172 0.1
173 0.1
174 0.11
175 0.1
176 0.09
177 0.09
178 0.09
179 0.08
180 0.07
181 0.06
182 0.05
183 0.05
184 0.06
185 0.05
186 0.08
187 0.11
188 0.15
189 0.18
190 0.2
191 0.25
192 0.29
193 0.34
194 0.42
195 0.48
196 0.52
197 0.58
198 0.62
199 0.61
200 0.6
201 0.61
202 0.57
203 0.57
204 0.52
205 0.47
206 0.43
207 0.4