Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6YFR9

Protein Details
Accession A0A6A6YFR9    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
48-77FGILRNLRKRKHCKLCPKHHPPRMKEQPSQBasic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 10, cyto_nucl 9.5
Family & Domain DBs
Amino Acid Sequences MRALRKEKFRNCLLSSFTRQQELTSRPISTDKYPFQSDGSKKSRKTDFGILRNLRKRKHCKLCPKHHPPRMKEQPSQHPSSVVGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.57
3 0.56
4 0.52
5 0.47
6 0.43
7 0.4
8 0.41
9 0.37
10 0.35
11 0.31
12 0.29
13 0.27
14 0.29
15 0.31
16 0.27
17 0.31
18 0.28
19 0.3
20 0.31
21 0.31
22 0.3
23 0.35
24 0.33
25 0.35
26 0.4
27 0.41
28 0.41
29 0.46
30 0.48
31 0.44
32 0.46
33 0.47
34 0.48
35 0.47
36 0.56
37 0.55
38 0.59
39 0.64
40 0.65
41 0.61
42 0.63
43 0.66
44 0.67
45 0.74
46 0.75
47 0.78
48 0.83
49 0.89
50 0.91
51 0.92
52 0.93
53 0.9
54 0.9
55 0.84
56 0.84
57 0.85
58 0.81
59 0.78
60 0.77
61 0.79
62 0.77
63 0.78
64 0.68
65 0.58