Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6A6YF98

Protein Details
Accession A0A6A6YF98    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
9-32DYVQKDPKPYKHPKLPYPKPTPLPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 10.333, mito_nucl 9.666, cyto 6, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029526  PGBD  
Pfam View protein in Pfam  
PF13843  DDE_Tnp_1_7  
Amino Acid Sequences MPRTSNNVDYVQKDPKPYKHPKLPYPKPTPLPAFEPLQINNYDAPGTPNIPPGLDQHDPVALFRLFFTDEMVEKMVRWTNEYAKDHRPSKGSATSICTGWKDYMAKLNSID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.51
3 0.56
4 0.63
5 0.68
6 0.7
7 0.75
8 0.78
9 0.83
10 0.85
11 0.86
12 0.84
13 0.82
14 0.77
15 0.75
16 0.69
17 0.61
18 0.55
19 0.48
20 0.42
21 0.36
22 0.34
23 0.28
24 0.27
25 0.24
26 0.21
27 0.18
28 0.15
29 0.13
30 0.11
31 0.12
32 0.1
33 0.11
34 0.11
35 0.13
36 0.12
37 0.12
38 0.13
39 0.12
40 0.17
41 0.16
42 0.15
43 0.13
44 0.15
45 0.15
46 0.14
47 0.16
48 0.1
49 0.09
50 0.09
51 0.1
52 0.09
53 0.09
54 0.1
55 0.08
56 0.09
57 0.1
58 0.11
59 0.1
60 0.09
61 0.12
62 0.14
63 0.13
64 0.15
65 0.17
66 0.21
67 0.3
68 0.34
69 0.36
70 0.41
71 0.49
72 0.5
73 0.5
74 0.47
75 0.41
76 0.44
77 0.46
78 0.41
79 0.37
80 0.39
81 0.38
82 0.36
83 0.36
84 0.31
85 0.27
86 0.25
87 0.27
88 0.23
89 0.23
90 0.31
91 0.3