Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6Y6G0

Protein Details
Accession A0A6A6Y6G0    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MRLRLRLRRRLRRRLSTILPLSHydrophilic
39-63ALFSCRCSRKCSRRCSRRCCCMRCCHydrophilic
NLS Segment(s)
PositionSequence
8-13RRRLRR
Subcellular Location(s) mito 19, plas 3, cyto 2, nucl 1, pero 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MRLRLRLRRRLRRRLSTILPLSSCLFPWYLILCTRRPAALFSCRCSRKCSRRCSRRCCCMRCCMRCRRRCYIVDGEEKDVINCDQGRIWREHLELVSKLSERIGGYGAPLRANQKVVKRQGGRGCTRSEKGVYV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.84
3 0.83
4 0.78
5 0.72
6 0.63
7 0.54
8 0.49
9 0.4
10 0.33
11 0.24
12 0.19
13 0.13
14 0.14
15 0.14
16 0.13
17 0.17
18 0.19
19 0.19
20 0.22
21 0.23
22 0.22
23 0.21
24 0.21
25 0.22
26 0.29
27 0.3
28 0.32
29 0.4
30 0.44
31 0.45
32 0.49
33 0.54
34 0.55
35 0.6
36 0.67
37 0.69
38 0.75
39 0.84
40 0.88
41 0.87
42 0.87
43 0.88
44 0.84
45 0.78
46 0.77
47 0.77
48 0.75
49 0.74
50 0.74
51 0.75
52 0.75
53 0.77
54 0.74
55 0.72
56 0.65
57 0.63
58 0.61
59 0.58
60 0.59
61 0.54
62 0.49
63 0.44
64 0.42
65 0.35
66 0.27
67 0.2
68 0.14
69 0.12
70 0.1
71 0.1
72 0.13
73 0.16
74 0.17
75 0.2
76 0.2
77 0.21
78 0.23
79 0.22
80 0.23
81 0.21
82 0.2
83 0.2
84 0.17
85 0.17
86 0.15
87 0.16
88 0.13
89 0.13
90 0.12
91 0.1
92 0.11
93 0.15
94 0.16
95 0.15
96 0.17
97 0.19
98 0.2
99 0.23
100 0.27
101 0.31
102 0.39
103 0.45
104 0.53
105 0.54
106 0.61
107 0.65
108 0.7
109 0.69
110 0.64
111 0.64
112 0.62
113 0.61
114 0.58