Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6Y0D9

Protein Details
Accession A0A6A6Y0D9    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
66-106ATRVTQQRRGRNPSCCRRRRLPKACRHRRELTMRRHKHEGLBasic
NLS Segment(s)
PositionSequence
84-89RRLPKA
91-93RHR
Subcellular Location(s) extr 11, plas 7, mito 3, nucl 2, cyto 2, cyto_nucl 2, pero 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MTADVLLGLVLSSLLVPFSRDVNIARPISPSWLTPPSAWSYSGRLRPHCVPLISADVLSRSKNGQATRVTQQRRGRNPSCCRRRRLPKACRHRRELTMRRHKHEGLIQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.05
4 0.06
5 0.08
6 0.09
7 0.1
8 0.12
9 0.16
10 0.23
11 0.23
12 0.23
13 0.23
14 0.23
15 0.26
16 0.25
17 0.22
18 0.2
19 0.22
20 0.23
21 0.21
22 0.23
23 0.23
24 0.23
25 0.23
26 0.2
27 0.22
28 0.26
29 0.32
30 0.33
31 0.31
32 0.34
33 0.36
34 0.39
35 0.37
36 0.32
37 0.26
38 0.24
39 0.25
40 0.21
41 0.18
42 0.14
43 0.12
44 0.13
45 0.12
46 0.11
47 0.08
48 0.1
49 0.14
50 0.15
51 0.18
52 0.2
53 0.24
54 0.31
55 0.39
56 0.4
57 0.44
58 0.51
59 0.55
60 0.61
61 0.66
62 0.65
63 0.66
64 0.74
65 0.77
66 0.8
67 0.79
68 0.78
69 0.79
70 0.84
71 0.85
72 0.86
73 0.86
74 0.86
75 0.89
76 0.93
77 0.91
78 0.88
79 0.84
80 0.83
81 0.83
82 0.82
83 0.82
84 0.82
85 0.82
86 0.81
87 0.81
88 0.73
89 0.69