Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6A6Y0C2

Protein Details
Accession A0A6A6Y0C2    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
9-36TSDPPRGEKAKRHRRHPKVSAAPPPRRABasic
NLS Segment(s)
PositionSequence
12-76PPRGEKAKRHRRHPKVSAAPPPRRAAPAAKAKKEEKERVVSPRRAFAAAAAKRAAEKAKKKAARA
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MTRANKPHTSDPPRGEKAKRHRRHPKVSAAPPPRRAAPAAKAKKEEKERVVSPRRAFAAAAAKRAAEKAKKKAARADKAYDGDVEDVLPRER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.66
3 0.65
4 0.69
5 0.72
6 0.73
7 0.74
8 0.79
9 0.83
10 0.89
11 0.87
12 0.87
13 0.86
14 0.85
15 0.85
16 0.83
17 0.8
18 0.75
19 0.7
20 0.6
21 0.52
22 0.46
23 0.39
24 0.37
25 0.4
26 0.43
27 0.44
28 0.47
29 0.47
30 0.52
31 0.56
32 0.54
33 0.47
34 0.45
35 0.45
36 0.5
37 0.56
38 0.55
39 0.49
40 0.47
41 0.45
42 0.4
43 0.36
44 0.3
45 0.32
46 0.27
47 0.29
48 0.25
49 0.23
50 0.23
51 0.25
52 0.27
53 0.25
54 0.31
55 0.37
56 0.47
57 0.52
58 0.55
59 0.62
60 0.67
61 0.69
62 0.68
63 0.66
64 0.64
65 0.62
66 0.59
67 0.51
68 0.42
69 0.33
70 0.27
71 0.21
72 0.15