Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4P7T9

Protein Details
Accession F4P7T9   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
176-195TLQVQRQLQQQQKNKRRRMHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto 6, mito 5, cyto_pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036224  GINS_bundle-like_dom_sf  
IPR010492  GINS_Psf3  
IPR038437  GINS_Psf3_sf  
Gene Ontology GO:0000811  C:GINS complex  
GO:1902975  P:mitotic DNA replication initiation  
CDD cd11713  GINS_A_psf3  
cd21693  GINS_B_Psf3  
Amino Acid Sequences MCDYWDLNTILAEQTKVRCHVKLPAYGYSFLAGAKDDSLLVNSIIDIPFWMGKPLALQAVVDLEIPTCFSDAVQDELLASPVCVKISLHCPFFFKFFADLLGILEIRRSFVELVTKTFKSRLCLLSDYTMTSRLGSEQSAFVQTLDATERHLYEAGLQSAEALSAWQRRDHIRRGTLQVQRQLQQQQKNKRRRMH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.23
3 0.28
4 0.3
5 0.28
6 0.3
7 0.38
8 0.41
9 0.44
10 0.44
11 0.46
12 0.46
13 0.46
14 0.44
15 0.36
16 0.3
17 0.23
18 0.19
19 0.12
20 0.09
21 0.08
22 0.08
23 0.07
24 0.07
25 0.08
26 0.09
27 0.08
28 0.07
29 0.07
30 0.08
31 0.08
32 0.08
33 0.07
34 0.07
35 0.08
36 0.09
37 0.1
38 0.08
39 0.08
40 0.09
41 0.1
42 0.1
43 0.08
44 0.08
45 0.07
46 0.08
47 0.08
48 0.08
49 0.07
50 0.06
51 0.06
52 0.06
53 0.06
54 0.05
55 0.05
56 0.04
57 0.07
58 0.08
59 0.1
60 0.1
61 0.09
62 0.09
63 0.09
64 0.1
65 0.08
66 0.07
67 0.05
68 0.06
69 0.06
70 0.06
71 0.06
72 0.07
73 0.14
74 0.18
75 0.19
76 0.2
77 0.22
78 0.22
79 0.25
80 0.23
81 0.17
82 0.15
83 0.13
84 0.13
85 0.11
86 0.1
87 0.08
88 0.08
89 0.07
90 0.06
91 0.06
92 0.05
93 0.06
94 0.06
95 0.06
96 0.06
97 0.07
98 0.13
99 0.13
100 0.17
101 0.21
102 0.21
103 0.21
104 0.25
105 0.25
106 0.23
107 0.27
108 0.26
109 0.25
110 0.27
111 0.28
112 0.28
113 0.27
114 0.26
115 0.22
116 0.21
117 0.17
118 0.16
119 0.14
120 0.12
121 0.12
122 0.1
123 0.11
124 0.1
125 0.11
126 0.12
127 0.12
128 0.11
129 0.1
130 0.09
131 0.09
132 0.1
133 0.09
134 0.1
135 0.11
136 0.12
137 0.13
138 0.13
139 0.12
140 0.14
141 0.18
142 0.16
143 0.15
144 0.15
145 0.13
146 0.13
147 0.13
148 0.09
149 0.06
150 0.08
151 0.12
152 0.14
153 0.16
154 0.19
155 0.27
156 0.34
157 0.42
158 0.48
159 0.5
160 0.55
161 0.61
162 0.67
163 0.67
164 0.68
165 0.68
166 0.64
167 0.61
168 0.61
169 0.62
170 0.61
171 0.63
172 0.65
173 0.68
174 0.72
175 0.8