Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6A6YFK6

Protein Details
Accession A0A6A6YFK6    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
48-77IQPPPRQQLSRQPRNKIKKKAVPQLRKDAQHydrophilic
NLS Segment(s)
PositionSequence
60-68PRNKIKKKA
Subcellular Location(s) nucl 13.5, mito_nucl 12.666, mito 10.5, cyto_nucl 9.333
Family & Domain DBs
Amino Acid Sequences MFNHVSERLYSGHRSWKIDIERPKDLCWLKGQGPVLSRMPSMQIILAIQPPPRQQLSRQPRNKIKKKAVPQLRKDAQTWKSATIRSEKHHEVAFRPTSRHYESLNKHLQLAFPHYLNDPSVRATIESLKSLCDTKPFADRYYYGNGSWVVSKIDQDRLHFKRSDECQFSIGQVQLVRAPFPPGPPLVQHRLKHFLRTIREVQVEAGNAEDDLELLNKPVIYGVMYAEYACSLRISGRYAKMRSKER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.42
3 0.48
4 0.51
5 0.55
6 0.6
7 0.57
8 0.62
9 0.59
10 0.59
11 0.59
12 0.54
13 0.48
14 0.44
15 0.43
16 0.37
17 0.41
18 0.41
19 0.36
20 0.36
21 0.38
22 0.36
23 0.32
24 0.29
25 0.23
26 0.23
27 0.21
28 0.19
29 0.15
30 0.12
31 0.11
32 0.12
33 0.15
34 0.14
35 0.15
36 0.18
37 0.19
38 0.23
39 0.26
40 0.26
41 0.27
42 0.36
43 0.46
44 0.53
45 0.59
46 0.65
47 0.72
48 0.81
49 0.87
50 0.86
51 0.86
52 0.85
53 0.86
54 0.87
55 0.87
56 0.86
57 0.84
58 0.84
59 0.8
60 0.74
61 0.66
62 0.64
63 0.57
64 0.54
65 0.49
66 0.42
67 0.4
68 0.38
69 0.39
70 0.37
71 0.38
72 0.35
73 0.4
74 0.37
75 0.36
76 0.36
77 0.36
78 0.31
79 0.34
80 0.37
81 0.32
82 0.31
83 0.31
84 0.33
85 0.35
86 0.35
87 0.3
88 0.33
89 0.34
90 0.42
91 0.46
92 0.41
93 0.39
94 0.37
95 0.35
96 0.27
97 0.3
98 0.23
99 0.17
100 0.17
101 0.17
102 0.17
103 0.16
104 0.15
105 0.1
106 0.1
107 0.1
108 0.09
109 0.09
110 0.09
111 0.12
112 0.12
113 0.13
114 0.12
115 0.11
116 0.12
117 0.13
118 0.12
119 0.12
120 0.12
121 0.12
122 0.19
123 0.2
124 0.21
125 0.22
126 0.23
127 0.23
128 0.28
129 0.28
130 0.21
131 0.21
132 0.2
133 0.19
134 0.18
135 0.16
136 0.11
137 0.1
138 0.12
139 0.12
140 0.19
141 0.2
142 0.22
143 0.31
144 0.32
145 0.37
146 0.37
147 0.36
148 0.37
149 0.41
150 0.47
151 0.42
152 0.4
153 0.37
154 0.35
155 0.36
156 0.31
157 0.25
158 0.19
159 0.14
160 0.14
161 0.15
162 0.15
163 0.15
164 0.12
165 0.16
166 0.15
167 0.15
168 0.17
169 0.16
170 0.17
171 0.19
172 0.25
173 0.3
174 0.37
175 0.38
176 0.41
177 0.49
178 0.48
179 0.51
180 0.51
181 0.5
182 0.48
183 0.52
184 0.52
185 0.5
186 0.5
187 0.45
188 0.41
189 0.37
190 0.31
191 0.24
192 0.2
193 0.14
194 0.12
195 0.11
196 0.09
197 0.06
198 0.06
199 0.07
200 0.06
201 0.07
202 0.08
203 0.07
204 0.07
205 0.08
206 0.08
207 0.08
208 0.08
209 0.09
210 0.1
211 0.1
212 0.1
213 0.1
214 0.1
215 0.1
216 0.1
217 0.09
218 0.07
219 0.09
220 0.12
221 0.16
222 0.23
223 0.31
224 0.39
225 0.44
226 0.52