Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6A6Y2V7

Protein Details
Accession A0A6A6Y2V7    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
126-147CGPSKGKRFLRCPKHIGKQCPFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR010666  Znf_GRF  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF06839  zf-GRF  
PROSITE View protein in PROSITE  
PS51999  ZF_GRF  
Amino Acid Sequences MCASLIRKELARPALTKRVQLPYLVLGCSQTFNPTSPNNPHHPPLRPLQTHQTPTTPLPPPLLRRHPPPLHPPSISRLQRPSQPKYGQIPTKTPTFRLYSRLGRLYKANWYCDCGLQATWERVNKCGPSKGKRFLRCPKHIGKQCPFILWEEHEAIAKKWFKCSRPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.47
3 0.5
4 0.48
5 0.49
6 0.47
7 0.44
8 0.4
9 0.36
10 0.36
11 0.32
12 0.26
13 0.2
14 0.2
15 0.2
16 0.18
17 0.14
18 0.13
19 0.14
20 0.18
21 0.18
22 0.24
23 0.3
24 0.35
25 0.38
26 0.41
27 0.44
28 0.46
29 0.48
30 0.46
31 0.47
32 0.5
33 0.47
34 0.47
35 0.52
36 0.54
37 0.53
38 0.52
39 0.46
40 0.4
41 0.39
42 0.41
43 0.35
44 0.28
45 0.28
46 0.29
47 0.32
48 0.38
49 0.44
50 0.41
51 0.44
52 0.52
53 0.52
54 0.54
55 0.58
56 0.57
57 0.53
58 0.51
59 0.47
60 0.42
61 0.48
62 0.45
63 0.39
64 0.37
65 0.34
66 0.39
67 0.44
68 0.44
69 0.43
70 0.43
71 0.44
72 0.45
73 0.49
74 0.48
75 0.44
76 0.43
77 0.36
78 0.42
79 0.38
80 0.34
81 0.31
82 0.3
83 0.29
84 0.29
85 0.33
86 0.32
87 0.35
88 0.41
89 0.38
90 0.36
91 0.37
92 0.34
93 0.37
94 0.35
95 0.36
96 0.29
97 0.32
98 0.32
99 0.31
100 0.3
101 0.22
102 0.18
103 0.17
104 0.2
105 0.2
106 0.22
107 0.25
108 0.25
109 0.26
110 0.3
111 0.3
112 0.31
113 0.35
114 0.39
115 0.44
116 0.51
117 0.6
118 0.65
119 0.69
120 0.75
121 0.77
122 0.8
123 0.8
124 0.8
125 0.79
126 0.8
127 0.81
128 0.81
129 0.78
130 0.77
131 0.71
132 0.65
133 0.57
134 0.49
135 0.45
136 0.38
137 0.35
138 0.28
139 0.27
140 0.27
141 0.27
142 0.26
143 0.3
144 0.33
145 0.29
146 0.37
147 0.43